KEGG   Sinorhizobium meliloti Rm41: BN406_05145Help
Entry
BN406_05145       CDS       T02332                                 

Gene name
melA3
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:smi00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:smi00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:smi00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMB:69914..71287
Genome map
AA seq 457 aa AA seqDB search
MTRQPRITFIGAGSTVFMKNIIGDILQRPALSAATIALMDVNPERLAESEIVAGKLARTL
GADARIETHSNQRKALEGADFVVVAFQIGGYEPCTVTDFEVPKKYGLRQTIADTLGVGGI
MRGLRTVPHLWKICEDMLEVCPEAILLQYVNPMAINTWAIAEKYPAIKQVGLCHSVQGTA
FELARDLDIPLDEIRYRAAGINHMAFYLKFEHRQKDGSYRDLYPDLIRGYREGRFPKPSH
WNPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKDGRPDLIEKFGIPLDEYPKRCVE
QIERWKGQAAAFKEAETIEVAESREYASSIMNSVWTGEPSVIYGNLRNNGCITSLPENCA
AEVPCLVDSSGIQPTYIGALPPQLTALIRTNINVQELTVQALVTENREHLYHAAMMDPHT
AAELDLDQIWSLVDDLLAAHRDWIPEWARVTKKVAAA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacgagacaacccaggattactttcatcggtgccggttccaccgttttcatgaaaaac
atcatcggcgacatattgcagcgcccggcgctttcggccgcgaccatcgccctgatggac
gtcaaccccgagcggctcgccgaaagcgagatcgtcgccggcaaactggcgcgcacactt
ggcgccgatgccaggatcgaaacccattcgaaccagcgcaaggctctggaaggagcggac
ttcgtcgtcgtcgccttccagatcggcggttacgagccctgcacggtcaccgacttcgaa
gtgcctaagaaatacgggctgcgtcagacgatcgccgacacgctgggcgtcggcggcatc
atgcgcgggctccgcaccgtgccgcatctctggaaaatctgcgaggacatgctcgaggtc
tgccccgaggcgatccttctgcaatatgtgaatcccatggcgataaacacctgggcgatc
gccgagaaatatccggcgatcaagcaggtgggcctctgccattcggtgcagggcacggcc
ttcgagcttgcccgggacctcgacattccactcgacgaaatccgctaccgcgccgccggc
atcaaccacatggcgttttatctcaagttcgagcaccgccagaaggacggcagctatcgc
gatctctatccggacctgatccgcggctaccgcgagggccgcttccccaagcccagccac
tggaacccgcgctgccccaacaaggtgcgctacgagatgctgacgcggctcggttatttc
gtcaccgagagctcggagcatttcgccgagtacacgccctacttcatcaaggacgggcgc
cccgatctgatcgagaaattcggcattccgctcgatgaatatccgaagcgctgcgtcgag
cagatcgagcgctggaaggggcaggcggccgccttcaaggaggcggagacgatcgaagtc
gcggagagccgcgaatatgcctcctcgatcatgaattcggtctggaccggcgaaccttcg
gtcatctacggcaacctcaggaacaatggctgcatcacctcgctgccggaaaactgtgcg
gcggaagtgccctgcctcgtcgattcatccggcatccaaccgacctatatcggcgccctg
ccgccgcagctcacggccctgatccgcaccaacatcaacgtccaggaattgactgtccag
gcgctcgtcaccgagaaccgcgagcatctctatcacgcggcgatgatggatccgcatacc
gccgccgagctcgatctcgaccagatctggtcgctcgtggacgatctgctcgcggcgcac
cgcgactggatccccgaatgggcccgtgtgacgaagaaggtagcggccgcctga

DBGET integrated database retrieval system