KEGG   Sinorhizobium meliloti Rm41: BN406_05254Help
Entry
BN406_05254       CDS       T02332                                 

Gene name
Hibch
Definition
(GenBank) 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00071  Fatty acid degradation
smi00280  Valine, leucine and isoleucine degradation
smi00281  Geraniol degradation
smi00310  Lysine degradation
smi00360  Phenylalanine metabolism
smi00362  Benzoate degradation
smi00380  Tryptophan metabolism
smi00410  beta-Alanine metabolism
smi00627  Aminobenzoate degradation
smi00640  Propanoate metabolism
smi00650  Butanoate metabolism
smi00903  Limonene and pinene degradation
smi00930  Caprolactam degradation
smi01100  Metabolic pathways
smi01110  Biosynthesis of secondary metabolites
smi01120  Microbial metabolism in diverse environments
smi01130  Biosynthesis of antibiotics
smi01212  Fatty acid metabolism
Module
smi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN406_05254 (Hibch)
   00650 Butanoate metabolism
    BN406_05254 (Hibch)
  Lipid metabolism
   00071 Fatty acid degradation
    BN406_05254 (Hibch)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN406_05254 (Hibch)
   00310 Lysine degradation
    BN406_05254 (Hibch)
   00360 Phenylalanine metabolism
    BN406_05254 (Hibch)
   00380 Tryptophan metabolism
    BN406_05254 (Hibch)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN406_05254 (Hibch)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN406_05254 (Hibch)
   00281 Geraniol degradation
    BN406_05254 (Hibch)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN406_05254 (Hibch)
   00627 Aminobenzoate degradation
    BN406_05254 (Hibch)
   00930 Caprolactam degradation
    BN406_05254 (Hibch)
Enzymes [BR:smi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN406_05254 (Hibch)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: CCM71536
Position
pSYMB:193346..194416
Genome map
AA seq 356 aa AA seqDB search
MEMQTTLPEVIVERQGAIGRLRLNRPRALNSLNRTMIRAIAAALTEFERDPEIAAVLVTG
EGERGLCAGGDIRMIYESGRERPGEGAQFWREEFIVNSRISAYSKPYIAIMDGIVMGGGV
GVSSHGSHRVVTERTRFAMPETGIGYFTDVGATWLLPRAPGEFGTYLGLTGRDIGAAAVI
HARLADSFVPSEMIGELLGALSSLSGSATADDVSAAIRAVSSEPPASALLDHLSVIDRCF
AFNAVEEIFAALEKDESDFARETLELLKTRSAISLKLTLSLLREGRSSATLNECLEREYA
ATLGMLSNPDFYEGVRAAVIDKDRNPKWSVGLSEATPELLARFGRNDGAPLFAGKE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggagatgcagaccacgcttccggaggtcattgtcgagcgccagggcgcgatcggcagg
ctgcggctcaaccgtccgcgcgcactgaatagcctcaatcgcacgatgatccgcgcgatc
gctgcggcgctgaccgaattcgagcgcgacccggagattgccgcagtgcttgtcacgggc
gagggcgaacggggcctctgcgccggcggcgacatccggatgatatacgaaagcggccgc
gaacggcctggggaaggtgcgcagttctggcgcgaggagttcatcgtcaacagccgaatt
tcagcctactccaagccctatatcgcgatcatggacgggatcgtgatgggcggcggcgtc
ggcgtttcctcccatggcagccatcgggtcgtgaccgagaggacgcgctttgccatgccg
gaaacggggatcggctatttcaccgatgtcggcgcgacctggctcctgccgcgcgcgccc
ggcgagttcggtacctatctcgggctgacgggccgcgatatcggtgcggcggcggtcatc
catgcgcggctcgccgacagtttcgttccctccgagatgatcggcgagctcctcggcgcg
ctctcctcgctttccggttcggccaccgccgatgacgtttcggcggcgatccgcgccgtt
tcgagcgagcccccggcatcggccctgctggaccacctgtcggtcatcgaccgttgcttc
gccttcaatgccgtggaggagatcttcgcggcgctggagaaggacgagtcggatttcgcg
cgcgagacgctcgaactcctgaagactcgatcggcgatcagtctcaagctgacgctgtcg
ctcttaagggaagggcgctccagcgcaacgctcaacgaatgcctcgagcgggaatatgcc
gcgaccctcggaatgctttccaatccggatttctacgagggcgtcagggccgcggtgatt
gacaaggaccggaatccgaaatggtcggtcgggctttcggaagctacccccgagctgctc
gcccgtttcgggaggaatgacggcgcgccgctcttcgccgggaaggaataa

DBGET integrated database retrieval system