KEGG   Sinorhizobium meliloti Rm41: BN406_05340Help
Entry
BN406_05340       CDS       T02332                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:smi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMB:280781..282718
Genome map
AA seq 645 aa AA seqDB search
MCGFGGYLGSIRDGKPLLERMTAAIGHRGPDERGIFTAPGAGLGHVRLSIVGLGDGQQPM
SDPSGELTIAFNGEIFNYVELRDELRARGRRFRTSSDTEVILHLYEEMGEDCLSLLNGDF
AFAIWDARRRRMMLARDRMGVRPLFHTLKGGTLYFASEVKALLEVPGVSAEIDPIALDQI
FTLWAPIAPRTPFRDIHELEPGHLMIADQNGTTTRPYWQLDYPDRDERPAYAEESRAAEE
LRALLTDATRIRMRADVPVGAYLSGGLDSSIISALAAGMTSQGLRTFSVTFDSAEHDESA
FQEEMAAALGTEHRAVACRAGDIARDFPDVIRFTEKPIIRTAPAPLYKLSGLVREAGLKV
VLTGEGADEVFAGYDIFKEARVRRFCGRQPRSRIRPHLFRKLYPYLPGLQQQSAEYLAAF
FGAGDVALDDPLFSHRPRLKGTAATKMFFSSDLRAELTGYDAAEELVSRLPAAFGRWHPL
HQAQYLESRFLLPGYILSSQGDRMAMAHGIEGRFPFLDHRLVEFAAKLPPEMKLRGLVEK
HILREATKDLLPPAIGRRTKQPYRAPDSHSFSGAGELDYVRSAMSEDAVAAGGLFNAKAV
TKLYEKCQTRPASGFRDNAAFVGVLSTQLWLQTFTGTSLRKAEAA
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggattcggcgggtaccttggttcaatacgggacggtaagccccttctcgaaagg
atgacggccgcgatcggccaccgcggcccggacgagcgtgggatcttcaccgcgccgggt
gcgggcctcggtcatgttcggctgtcgattgtggggctcggggacggccagcagccgatg
tccgacccgagcggcgagttgacgatcgccttcaatggcgaaatcttcaactatgtggag
ttgcgcgacgaactgcgcgccagaggccgccggttccgcacctccagcgatacggaggta
atcctccatctttacgaagagatgggcgaggactgtctctctctcctcaacggcgatttc
gccttcgcgatctgggacgcacgccggcgccggatgatgctcgcgcgcgaccgcatgggt
gtgcgcccactcttccacactttgaaaggcggcacgctctatttcgcatccgaggtcaag
gcgctcctcgaagttccgggggtctccgcagagatcgacccgatcgcgctcgaccagata
ttcaccctatgggcgccgatcgcgccgcgtacgcccttccgtgacatccacgagctcgag
cccgggcatctgatgatcgccgatcagaacggcaccacgacaaggccctattggcagctc
gactatccggaccgggacgagcgcccagcctatgcggaggaaagccgcgctgcggaggaa
ttgcgcgcgctcctgacggacgcgacgcggatccgcatgcgggccgatgtgcccgtcggc
gcctatctttccggaggcctcgattcgtccatcatctcggcgctggcggccgggatgacg
tcccaaggcttgcgcaccttctccgtcaccttcgatagcgcggagcatgacgaaagcgca
ttccaggaggagatggcagcggcgctcggaaccgaacaccgcgcggtcgcatgccgcgcc
ggcgacatcgccagggactttcccgatgtcatccgctttaccgagaagccgatcatccgc
actgcgcccgcgccgctctacaaattgtccggcctggtgcgcgaggcgggtctgaaagtg
gtgctgacgggcgagggcgccgacgaggtattcgccggttacgatatcttcaaggaagcg
cgcgtccgccgtttctgcggccggcaaccccgctcgcggatcaggccgcatctgttccgc
aagctttacccctatctgccaggcctgcagcagcagtcggccgagtatctcgccgccttt
ttcggcgccggcgacgtggccctcgacgacccgctcttttcgcatcggccacgcctcaag
ggcacggcggcaaccaagatgttcttctcctcggacctgcgcgccgaactcacgggctat
gacgcggcggaagaattggtcagccggctccccgccgccttcggccgctggcatccgctg
catcaggcccaatatctcgaaagccgcttcctgctgcccggatatattctctcgagccag
ggcgaccgcatggcgatggcgcatgggatcgagggccgtttcccgttcctcgaccaccgc
ctcgtcgaattcgccgcaaagctgccgccggaaatgaaactcagagggctcgtcgagaag
cacatcctgcgcgaggcgacgaaagacctgctgccgccggcgatcggccggcggacgaag
cagccctatcgcgctccggacagccactccttcagcggcgcgggcgaactcgattatgtg
cgctccgccatgagcgaggacgcggtcgccgccggcgggctcttcaacgccaaagcggta
acgaaactctacgagaaatgccagacgcgccccgcctcgggctttcgcgacaacgcggcc
ttcgtcggcgtcctgtcgacgcaactctggctgcagacattcaccggcaccagccttcgc
aaggctgaggccgcgtaa

DBGET integrated database retrieval system