KEGG   Sinorhizobium meliloti Rm41: BN406_05415Help
Entry
BN406_05415       CDS       T02332                                 

Gene name
gst12
Definition
probabable glutathione S-transferase protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BN406_05415 (gst12)
Enzymes [BR:smi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN406_05415 (gst12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMB:355685..356407
Genome map
AA seq 240 aa AA seqDB search
MPYKLYYWDGIPGRGEFVRLALEEAGADYLDIARQPGGTNEMLKLMKMPGEAAAPFAPPF
LIDGDLVISHVANILFYLGPRLGLVAEDEGPRTLTNGLQLTITDFVAEIHDTHHPVALSL
YYEDQKPEALRRSADFLSERLPKFLGYFERVLTQNPRGPKHMVGDRLSYVDLSLFQVIEG
LRYAFSKAMDAYETNIPGLVALHDAVRARPRILSYLASERRLAFNESCVFRHYPELDRQS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgccatacaagctctattactgggacggcattcccggtcgcggtgaattcgtgcgcctt
gcgctggaggaggccggcgcggattacctcgacattgcccgccagccgggcggcacgaat
gaaatgctgaagctgatgaagatgcccggtgaagccgccgctcccttcgctcccccgttc
ctcattgatggcgacctcgtcataagccacgtcgccaacatacttttttatctcgggccg
aggctcggcctcgttgctgaggacgaggggcctcgaaccctcaccaatggtctgcagctg
acgatcaccgacttcgtcgcggagattcacgacacgcaccatccggtcgccttgtcgctc
tattatgaggaccagaagcctgaagcgctgaggcggtcggccgatttcctctcggagcgc
ctgccgaagtttctcggctatttcgaacgcgtgctcacacaaaatcccaggggcccgaaa
catatggtcggggaccggctgagctacgtcgatctttcgcttttccaggtgatcgaagga
cttcgctatgccttttccaaggcgatggatgcctatgagacaaacattcccggactggtc
gccttgcacgatgccgttcgtgcacggccgagaattctgagctatctggcctcggagcgg
cggcttgccttcaacgaatcctgcgtcttccgccactatccggaactcgaccggcagtcc
tga

DBGET integrated database retrieval system