KEGG   Sinorhizobium meliloti Rm41: BN406_05584Help
Entry
BN406_05584       CDS       T02332                                 

Gene name
exoN
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BN406_05584 (exoN)
   00052 Galactose metabolism
    BN406_05584 (exoN)
   00500 Starch and sucrose metabolism
    BN406_05584 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    BN406_05584 (exoN)
Enzymes [BR:smi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BN406_05584 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMB:complement(531313..532218)
Genome map
AA seq 301 aa AA seqDB search
MDRVRTVRKAVIPVAGNGTRFLPATKAVPKEMLTIVDRPVVQYAVDEARQAGIEHIVFVT
SRNKQVIEDHFDDAPELISSLSRSGKSAQISELEAMLPAAGSVSFTRQQAPLGLGHAVWC
ARDLIGDEPFALLLPDMVSFGARGCVAGLMDLYHEVGGNVVGVEQCAPEEASKYGIVGKG
ETVRHGFSVTEMVEKPAAGKAPSNYYLNGRYILQPEIFSILAHQTRGAGNEIQLTDGMLT
LSQSQSFHAHPYEGRTFDCGSKQGFIEANVAFALARADIGDIVFESVRDMVLSHESRIRA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtgtcaggaccgtcagaaaagcagtaatcccagttgccggaaacggaacgagg
ttccttccggcgacgaaggcagtgcccaaggagatgttgacgatcgtcgaccggccagtc
gttcagtatgccgtggacgaggcccgccaggccggcatcgagcatatcgtcttcgtcacc
agccggaacaagcaggtgatcgaggaccatttcgacgacgcgccggagctcatctcgtca
ctttcacgttccggcaaaagcgcgcagatttccgaactcgaggccatgttgccggcagcc
ggctcggtcagctttacccgtcagcaggcccccctcggcctcgggcacgcggtatggtgt
gcgcgtgacctgatcggcgacgagcccttcgcgcttctgctgccggacatggtctccttc
ggcgcgcgcggttgcgtggccggtctcatggacctctatcacgaggttggcggcaacgtc
gtcggcgtcgagcaatgcgcccccgaggaagcatcgaaatacggcatcgtcggcaagggc
gagacggtccggcacggtttctccgtgaccgagatggtcgaaaagcccgccgccggaaag
gcgccgtccaactactatctcaacggccgctacatccttcagccggaaatcttctcgatt
ctggcccatcaaacgcgcggcgccggcaatgagatacagttgaccgatggcatgctgacg
ctttcgcaatcccagtccttccacgcgcatccctatgagggccgcaccttcgactgcggt
tcgaagcagggcttcatcgaagccaatgtcgccttcgcccttgctcgtgcggacatcggc
gatatcgttttcgaatccgtccgcgacatggttctgtctcacgaaagccgcatccgggcg
gcataa

DBGET integrated database retrieval system