KEGG   Sinorhizobium meliloti Rm41: BN406_06170Help
Entry
BN406_06170       CDS       T02332                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:smi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN406_06170
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BN406_06170
Enzymes [BR:smi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BN406_06170
Two-component system [BR:smi02022]
 CheA family
  CheA-CheYBV
   BN406_06170
Bacterial motility proteins [BR:smi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BN406_06170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMB:1198736..1199548
Genome map
AA seq 270 aa AA seqDB search
MGRRDVIAIGGSLGAVAALKHLLGKLPGDFAAAVFVVVHVGARGKDLLAEIFNAHSGIPV
TTAVDGEAVERRHVYVAPADHHLLVIDGVIRLGRGPRENLARPAVDPLFRSIGLNYGPRS
VAVVLTGLLNDGAAGLADFKRCGGVTVVQNPSDAVAPDMPMGALRASDVDYRAPLDGLAA
LLVELTGEEAGPPIPVPAEIRLEVDIAFGRQIGSETMLTIANPVPISCPACGGVLSQIKS
WPPLRFRCQVGHAYTSELWLRSRKAPSTRL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggccgccgagacgtcatagccataggaggttcgcttggcgcggtggcagccctgaag
cacttgcttggcaaacttccgggcgacttcgccgccgctgtattcgtcgtcgtacatgtc
ggcgcacgcggaaaagatctactcgccgagatattcaacgcgcattccggaattcctgta
acgactgcagttgacggggaggctgtagagcgccggcacgtctatgttgcgccggcagac
caccacctcctcgtcattgacggcgtcatccggcttggccgcgggccccgcgagaacctg
gcccgaccggcggttgaccctctctttcgatcaatcggtttgaattacggaccgcggtca
gtcgcggtcgtactcacggggctgttgaacgacggggccgctggccttgccgatttcaag
cggtgcggtggggtgacagtcgtccagaatccaagcgacgcagttgcgccggacatgcca
atgggcgccctaagggcaagcgacgtcgattaccgcgctcctctcgacggtctcgctgca
ctcctcgttgagctcaccggcgaagaggccggtccgccaattcccgtccccgccgaaatc
agacttgaggtcgatatcgcattcggccgacagatcggttccgagacaatgctaaccatt
gcgaacccggtcccgatctcgtgtccggcctgtggcggcgtactctcgcagatcaagagt
tggccgccgctgcgatttcgttgtcaagtcgggcatgcctatacgtccgagctttggctg
cggagtcggaaggcgccgtcgacgagactctga

DBGET integrated database retrieval system