KEGG   Sinorhizobium meliloti Rm41: BN406_06204Help
Entry
BN406_06204       CDS       T02332                                 

Gene name
asnO
Definition
protein AsnO
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN406_06204 (asnO)
Enzymes [BR:smi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BN406_06204 (asnO)
Peptidases [BR:smi01002]
 Cysteine Peptidases
  Family C44
   BN406_06204 (asnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYMB:complement(1239309..1241105)
Genome map
AA seq 598 aa AA seqDB search
MEVSTRFMCGICGEVRFDGGSPSVAAVSIMADVLAPRGPDASGVVVRGNVGLGHRRLRIL
DLSDKSQQPMVDPDLGLSLVFNGCIYNFRELRSVLEEKGYRFFSSGDTEVILKAWHAWGE
ECVSRFHGMFAFVIHERDSGRVVMARDRFGIKPLYIAEVQGALRFASALPALVKAGGVDT
SIDVAALHNYMTFHAVVPPPRTILNGVRKLPPATLRVYERDGSFEDRRYWDPPYRRQAGD
AAIRREEWQEQLLDALRIAVKRRMIADVPVGVLLSGGVDSSLIVGLLTEAGQRGLMSFSV
GFEEANGEKGDEFVYSDLIAGHFGTDHRKIFVPSADLMGALPGTIAAMSEPMVSYDNVGF
YLLSKEVSKHVKVVQSGQGADEVFGGYHWYPPLMNSNDVVADYGKAFRDRSHAVLTTQLS
DAWIADHDVSGDLLNEHLLREGADTPVDQALRLDSSVMLVDDPVKRVDNMTMAWGLEARV
PFLDHELVELAARMPPEEKLRDGGKGILKDVARRVIPSEVIDRKKGYFPVPQLKYIAGPY
LDLIRDTLRSQKARDRGIFKDAYLDRLFERPSDHITPLRGSELWQVGLLEMWLEAQGV
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggaggtttcgacccggttcatgtgtggaatttgtggagaagtcaggttcgacggcggt
tcgccgtcggttgcggcagtctcgatcatggcggacgtccttgcccctcgcgggccggat
gcgtcaggcgtggtggtgcgcggcaatgtcgggctgggacaccggcgattgcgtatcctc
gacctctccgacaagtcgcagcagccgatggtcgatcctgacctcggcctgtcgctcgtc
ttcaacggttgcatctacaattttcgcgaactgaggtcggtgcttgaggagaagggttac
agattcttctcgtccggggataccgaggtcatcctgaaggcgtggcatgcctggggcgag
gaatgcgtctcgcgcttccatggcatgttcgccttcgtcattcacgagcgtgacagcgga
cgtgtcgtcatggcgcgcgaccgcttcggcatcaagccgctttatatcgccgaagtccaa
ggcgccttgcgcttcgcttccgccttgcccgcgctcgtcaaggcgggtggagtcgacacc
tcgatcgacgtggctgcccttcacaactacatgacctttcacgcggtcgtgccgccgccg
cgcacgatcctgaacggcgtgcgcaagctgccgcctgcgacccttcgcgtttatgaacgc
gacggcagcttcgaggaccggcgctactgggatccgccctatcgccgccaggcaggtgac
gcagccataaggcgtgaggaatggcaggagcagcttttggacgcgctgcggattgccgtg
aagcgtcgaatgatcgccgacgtgccggtcggcgtgcttctttccggcggcgtcgattct
agcctgatcgtcgggctgcttacggaagcgggccagcgcggtctcatgagcttttccgtc
ggcttcgaggaggcgaacggcgaaaagggtgacgaattcgtctattcggacctgatcgcc
ggtcacttcggtacggatcatcgcaagatattcgtcccctccgccgatctgatgggggcc
ttgcccgggaccatcgccgcaatgtccgagccgatggtctcctatgacaatgtcggcttc
tatctgctctcgaaggaggtttcgaagcacgtcaaggtcgtacagtcggggcagggtgcg
gacgaggtcttcggcggttaccactggtacccgccgctgatgaactccaacgacgtcgtt
gcggattacggcaaggccttccgcgaccgttcccacgcggttttgaccacccagttgtcg
gatgcctggattgccgaccacgacgtgagtggcgacttgctgaacgagcacctcctgcgc
gagggtgccgatacgcccgtcgatcaggcgctccgcctcgacagcagcgttatgctcgtc
gacgaccccgtgaagcgcgtcgacaatatgaccatggcctggggcctcgaagcgcgcgtg
cctttcctcgaccacgagctggtggaacttgccgcgcgcatgcccccggaggagaagctg
cgcgacggcggcaagggcattctgaaggacgtggcgcgccgggtcattccgagcgaggtc
atcgaccgcaagaagggctatttcccggtgccgcagctcaaatatatcgccggtccgtat
ctcgacctgatccgcgacaccttgcgctctcagaaggcgcgcgaccggggcatcttcaaa
gacgcttatctcgaccgcctgttcgaacggccgtcggatcacatcacgccgctacgcggc
tccgaactgtggcaggtcggactgcttgaaatgtggcttgaagcgcagggggtgtag

DBGET integrated database retrieval system