KEGG   Sinorhizobium meliloti Rm41: BN406_06666Help
Entry
BN406_06666       CDS       T02332                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BN406_06666
Enzymes [BR:smi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BN406_06666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRM41A:60504..61403
Genome map
AA seq 299 aa AA seqDB search
MSLGFAVNVTEASDVHVDTSIYRTIMVHGPARPRKGETVTGDRWHPKCGGKGGNQAVSAA
KTGIRTSMIGAVADDEFGRALTENLRRNSLDRRFVKIVGGVGSGMSVAIFDSEGDYGAVI
VSGSNLTLAQSDVDEAAELFVGNGVLVLQNEVPDHANVSAARAMKSVGGRVILNAAPARP
LSAELTALVDIIVVNAIEAEQLAEAPMVDTLQGALNAAKLLAGKFPVAIVTAGGEGVACA
TNQGEEFSIEAIKVELVSTHGAGDEFTGVLAAELAKGAAIEEALQAANLAAAKLVSLGG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgggctttgcggtcaatgttaccgaggcctccgatgtgcatgtggacacctcg
atttaccgcacaatcatggtgcatggccccgcgcgccctcgaaaaggtgagacggtcacc
ggggaccggtggcatccgaagtgcggtggcaaggggggcaaccaggctgtgtcggcggcc
aagacaggcatccggacctctatgatcggcgcggtcgccgacgatgaattcggccgcgcc
ctgacagagaacctgcgtcgaaacagcctcgaccgccggttcgtgaaaatcgtgggcggt
gtcggaagcggcatgagcgtcgcgatcttcgacagtgaaggcgattacggcgcggtcatc
gtctcgggcagcaatctcaccctcgcacaatcagacgtggacgaggccgcggaactattc
gtcggcaatggagtgcttgtgctgcagaacgaggtcccagatcacgccaacgtctcggcc
gcccgcgccatgaagtccgtcgggggcagggtcatcctcaatgccgcaccggcccgtcct
ctctcggcggagctgacggctttggtcgacatcatcgtcgtcaacgccatcgaagcggag
caattggccgaggctccaatggttgacacgctgcagggagcgctgaatgccgcgaagctg
ttggcggggaagtttccggtcgcaatcgtgacggctggcggagaaggggtcgcctgcgca
acgaaccaaggggaagagttctcgattgaagcgatcaaggtcgaactcgtgagcacccac
ggcgccggagatgagttcaccggcgttctcgccgcggagcttgccaaaggcgcggcgatc
gaagaggcgctgcaggcggcgaacctcgccgcggcgaaattggtctcgcttggcggttaa

DBGET integrated database retrieval system