KEGG   Sinorhizobium meliloti Rm41: BN406_06766Help
Entry
BN406_06766       CDS       T02332                                 

Gene name
acoC1
Definition
Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:smi01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:smi00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:smi00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:smi00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRM41A:167264..168391
Genome map
AA seq 375 aa AA seqDB search
MSSIEAVTVPKWGMTMTEGKITQWMVGEGDPVTRGQEILEIETTKVTNVVEAAASGTLRR
IVLAEGTTAPVGALAGVIADEVATPEEIDAFIESYADRLGGGDEGEGGAAVPRTIVVDGG
AINLLEAGPQSDETVVLLHGFGGDLSTWLFNQSALAENMRVVAIDLPGHGASSPIAGGDI
FPKIVSAVEAAVEAVAPGKLHLIAHSFGGAVAAAIAANRPSRVASLTLIAPIGLSRQISR
EFLVDFVAAERRRPLHSVLERLFADPSKITSDMVEGTLRFKRLEGVPEALSAIADTIADD
HGQVQSIGGQLAALTCPVTILWGERDAIVPVPQQADLPANARLRIIPGIGHMPQMEASSA
VNEAILENLQRSSGI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaatcgaggcagtcaccgttcccaaatggggaatgacgatgaccgaaggcaag
atcacccagtggatggtcggcgagggtgaccctgtcacgcgcggccaggaaatcctggag
atcgaaaccacgaaggtcaccaatgtcgtcgaagccgccgccagcggcacgctgagacgc
atcgtccttgccgagggaaccacggcgccggtcggcgcgctcgccggcgtgatcgccgac
gaagtggcgacgccggaagagatcgacgccttcatcgaaagctacgccgaccggcttggc
gggggcgacgaaggcgaaggtggcgccgccgtgccgcgcacgatcgtagtcgatggcggc
gcgatcaaccttctcgaggcgggaccgcagagcgatgagacggtggtgctgctgcacggg
tttggcggcgacctttcaacctggctgttcaatcagtcggcgctcgccgaaaacatgcgg
gtggtcgccattgatctgcccggacacggcgcgtcgtcgccgatcgcgggcggcgatatc
ttcccgaagatcgtctctgccgtggaagcggcggtcgaagcggtcgcgcccggcaagctt
cacctcattgcccactccttcggcggggctgttgccgcggcaatcgccgccaatcggccc
tcgcgcgtggcttcgctgacgctgatcgcgccgatcgggctgagccggcagatcagccgg
gagttcctcgtcgacttcgttgcggccgagcgccgccgtccgctgcacagcgtgctggag
cggctattcgccgacccgtcgaagattaccagcgacatggtcgagggaacgcttcgcttc
aagcggctcgagggcgtgccggaggcactctcggcaattgccgacacgattgccgacgac
catggtcaggtgcagtcgatcggcggtcagcttgcggcattgacctgtccggtgacgatc
ctgtggggcgagagggatgcgatcgtccccgttccgcagcaagccgacctgcccgccaac
gcccggctgcgcatcatccccggcatcggtcatatgccgcagatggaggcatcctcagcc
gtcaacgaagccattctggagaaccttcagcgctcgtcaggaatttga

DBGET integrated database retrieval system