KEGG   Sinorhizobium meliloti Rm41: BN406_06766Help
Entry
BN406_06766       CDS       T02332                                 

Gene name
acoC1
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
smi  Sinorhizobium meliloti Rm41
Pathway
smi00010  Glycolysis / Gluconeogenesis
smi00020  Citrate cycle (TCA cycle)
smi00620  Pyruvate metabolism
smi01100  Metabolic pathways
smi01110  Biosynthesis of secondary metabolites
smi01120  Microbial metabolism in diverse environments
smi01130  Biosynthesis of antibiotics
smi01200  Carbon metabolism
Module
smi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN406_06766 (acoC1)
   00020 Citrate cycle (TCA cycle)
    BN406_06766 (acoC1)
   00620 Pyruvate metabolism
    BN406_06766 (acoC1)
Enzymes [BR:smi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BN406_06766 (acoC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Biotin_lipoyl Hydrolase_4 Ser_hydrolase Thioesterase Biotin_lipoyl_2 RnfC_N HlyD_3 DUF1057 DUF676
Motif
Other DBs
NCBI-ProteinID: CCM69703
Position
pRM41A:167264..168391
Genome map
AA seq 375 aa AA seqDB search
MSSIEAVTVPKWGMTMTEGKITQWMVGEGDPVTRGQEILEIETTKVTNVVEAAASGTLRR
IVLAEGTTAPVGALAGVIADEVATPEEIDAFIESYADRLGGGDEGEGGAAVPRTIVVDGG
AINLLEAGPQSDETVVLLHGFGGDLSTWLFNQSALAENMRVVAIDLPGHGASSPIAGGDI
FPKIVSAVEAAVEAVAPGKLHLIAHSFGGAVAAAIAANRPSRVASLTLIAPIGLSRQISR
EFLVDFVAAERRRPLHSVLERLFADPSKITSDMVEGTLRFKRLEGVPEALSAIADTIADD
HGQVQSIGGQLAALTCPVTILWGERDAIVPVPQQADLPANARLRIIPGIGHMPQMEASSA
VNEAILENLQRSSGI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaatcgaggcagtcaccgttcccaaatggggaatgacgatgaccgaaggcaag
atcacccagtggatggtcggcgagggtgaccctgtcacgcgcggccaggaaatcctggag
atcgaaaccacgaaggtcaccaatgtcgtcgaagccgccgccagcggcacgctgagacgc
atcgtccttgccgagggaaccacggcgccggtcggcgcgctcgccggcgtgatcgccgac
gaagtggcgacgccggaagagatcgacgccttcatcgaaagctacgccgaccggcttggc
gggggcgacgaaggcgaaggtggcgccgccgtgccgcgcacgatcgtagtcgatggcggc
gcgatcaaccttctcgaggcgggaccgcagagcgatgagacggtggtgctgctgcacggg
tttggcggcgacctttcaacctggctgttcaatcagtcggcgctcgccgaaaacatgcgg
gtggtcgccattgatctgcccggacacggcgcgtcgtcgccgatcgcgggcggcgatatc
ttcccgaagatcgtctctgccgtggaagcggcggtcgaagcggtcgcgcccggcaagctt
cacctcattgcccactccttcggcggggctgttgccgcggcaatcgccgccaatcggccc
tcgcgcgtggcttcgctgacgctgatcgcgccgatcgggctgagccggcagatcagccgg
gagttcctcgtcgacttcgttgcggccgagcgccgccgtccgctgcacagcgtgctggag
cggctattcgccgacccgtcgaagattaccagcgacatggtcgagggaacgcttcgcttc
aagcggctcgagggcgtgccggaggcactctcggcaattgccgacacgattgccgacgac
catggtcaggtgcagtcgatcggcggtcagcttgcggcattgacctgtccggtgacgatc
ctgtggggcgagagggatgcgatcgtccccgttccgcagcaagccgacctgcccgccaac
gcccggctgcgcatcatccccggcatcggtcatatgccgcagatggaggcatcctcagcc
gtcaacgaagccattctggagaaccttcagcgctcgtcaggaatttga

DBGET integrated database retrieval system