KEGG   Streptococcus mutans LJ23: SMULJ23_0123Help
Entry
SMULJ23_0123      CDS       T02086                                 

Gene name
adhE
Definition
putative alcohol-acetaldehyde dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
smj  Streptococcus mutans LJ23
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SMULJ23_0123 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SMULJ23_0123 (adhE)
   00620 Pyruvate metabolism
    SMULJ23_0123 (adhE)
   00650 Butanoate metabolism
    SMULJ23_0123 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SMULJ23_0123 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SMULJ23_0123 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SMULJ23_0123 (adhE)
   00626 Naphthalene degradation
    SMULJ23_0123 (adhE)
Enzymes [BR:smj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SMULJ23_0123 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SMULJ23_0123 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
146552..149221
Genome map
AA seq 889 aa AA seqDB search
MAKETKTEALTAEEAAKQYTNSLVEKALKAEKVYATYTQEQVDKIVAAMALAGSEASLQL
AKEAHEETGRGVVEDKDTKNHFATEYVYERIKNEKTVGIIGEDKVAGSIEIAAPLGVLAG
IVPTTNPTSTTMFKILVALKTRNAIVFAFHPAAQKCSAHAAQILYDAAVKAGAPENIVQW
IETPSIANTGALISNKGIASILATGGPGMVNAALKSGNPSMGVGAGNGAVYVDATANLER
AVEDLLLSKRFDNGMICATENSAVVEAPIYKEWLAKMQEKGAYLVPKKDYKKFEDFVFND
NHGVNGPVAGMSAKWICEQAGVTLPEGKDVLLFELDKKKIGEKLSSEKLSPLLSVYKAKD
RKDGIDIVAALLDYQGAGHNCAIQIGSQADPFVAEYGDALNSSRVLVNQPDSVGGIGDVY
TDALQASLTLGTGSWGKNSLSHNLSTGDLLNVKTVAKRRNRPQWVRLPEKTYYEKNAISY
LQDETETMTRAIIVADPGMLQFGFVDTVLAQLSLRDEKVATSIYGTIKPDPTLGQTIEIA
RQMRDFKPDTVIAVGGGSALDAAKIARYIYEYSLDQEADFLDSYEKVSELFLELQQKFID
IRKRIVRFKHQTVTRLFCIPTTSGTGSEVTPYAVITDDFTHVKYPLTDYELTPQVAIVDP
EFVMTVPKRTVALSGLDTLSHALESYVSVMASDFTRPWSMEAIRLVIENLEDSYNFDPKN
PTLRGEQARENMHYAATLAGMAFSNAFLGINHSLAHKTGGEFGLPHGLAISIAMQHVIRY
NGVAGNVKRSVYPRYEEYRAQRDYADIARALGLKGKDDAELVEALCARIDQLMHAVDVEP
KLSANGVTKKAFDAAVDRLASLAYDDQCTPANPRQPYIEEMKQLLIDQF
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaacaaaaacagaagcactcactgctgaagaagcagctaagcagtatacg
aatagcttagttgaaaaagcgttaaaggctgaaaaagtttatgcaacttatacacaagaa
caggtagataaaattgttgcagctatggcgcttgctggttctgaggcgtccctgcagtta
gctaaagaagctcacgaagaaacaggccgtggggttgtcgaagataaagatactaaaaac
cactttgcgacagaatatgtatatgaacgcataaaaaatgaaaaaacggttggcatcatt
ggtgaagataaagttgctggcagtatcgaaattgcagcaccacttggtgtcttggcaggt
atcgtaccaacaactaacccaacatcaacgactatgtttaaaatcttagtcgcattgaaa
acacgcaatgcaatcgtctttgctttccacccagcagctcaaaaatgttctgctcatgcc
gcccaaatcttgtatgacgcggcggttaaagccggcgctcctgaaaatattgttcaatgg
attgaaacaccatccatcgcaaacacgggagctttgatttccaacaaaggcattgcttca
atccttgcaactggcggacctggcatggttaatgcagcccttaaatctggtaatccatcg
atgggggttggtgcaggtaatggtgctgtttatgtggatgcaactgctaatcttgaacgt
gcggttgaagaccttcttctttctaagcgttttgacaatggtatgatttgtgcgactgaa
aactcggcagttgtggaagcacctatttataaagaatggcttgctaaaatgcaggaaaaa
ggcgcttaccttgttcctaaaaaagattacaaaaaatttgaagattttgtctttaatgac
aaccatggtgttaacggaccggttgctggtatgtcggcgaaatggatctgtgaacaagcc
ggtgtgacattgccagaaggcaaagatgttctcttatttgaacttgataagaaaaaaatt
ggtgagaaattatcatcagaaaaactctctccgcttctttctgtttataaagccaaagat
cgcaaagatggtattgatattgtagcagcccttcttgattaccaaggtgctggtcataac
tgtgctatccaaatcggttcacaagctgacccatttgttgctgaatatggagatgccctc
aattcatctcgtgttttggttaaccaaccagactcagtcggtggtatcggtgacgtttat
acagacgcattgcaagccagcttaactcttggaacaggatcatgggggaaaaattcattg
tcacacaacttatcgactggcgacctcttgaatgtgaaaactgttgcgaaacgccgcaac
cgtcctcaatgggttcgtttaccagaaaaaacttactacgaaaaaaatgctatttcatac
ttgcaggatgaaactgaaacaatgacgcgtgctatcatcgttgccgatccaggtatgctt
caatttggttttgttgacactgtccttgctcagctatcccttcgggatgaaaaagtggca
acttcaatttatggtactatcaaaccagatccaacactcggtcagactattgaaattgct
agacaaatgcgtgacttcaaaccagatactgttattgcagttggtggcggttctgccctt
gatgcagccaaaattgcgcgttatatctatgaatattcgttggatcaagaagcagatttc
cttgatagttatgaaaaagtcagtgagctcttccttgaattgcagcaaaaattcattgat
attcgtaagcggattgttcgcttcaagcatcagacagtgactcgtctcttctgtatccca
acaacatctggtacgggttcagaagtgacaccttatgccgttattactgatgatttcaca
cacgtgaaatacccattgactgattatgaattgacaccgcaagttgctattgttgatcca
gaatttgtcatgacagtgcctaaacgtacagtagctctttcaggacttgatactttgtca
catgctcttgaatcttacgtatctgttatggcatctgatttcacacgtccatggtctatg
gaagctatcagattggttatcgaaaacttggaagattcttataactttgatcctaagaat
ccaacacttcgtggagaacaagcacgtgaaaatatgcattatgcagcaactttagcaggt
atggccttctcaaatgccttccttggaattaaccactcacttgctcacaagactggcggt
gaatttggccttcctcatggtcttgctatatcaattgctatgcagcatgttattcgctac
aatggcgttgcaggaaatgtgaaacgttctgtttacccgcgttatgaagaataccgtgcc
caacgtgattatgcggatattgctcgcgctcttggacttaaagggaaagatgatgcagaa
ttggttgaagcactctgtgcacgtattgatcaattaatgcatgctgtagatgttgagcct
aagttatctgctaatggggttactaagaaggcttttgatgcagctgttgatagattggca
agcttggcttatgatgatcaatgtacaccagctaatccacgtcagccttacattgaagag
atgaagcagctcttgattgatcagttctaa

DBGET integrated database retrieval system