KEGG   Streptococcus mutans LJ23: SMULJ23_0559Help
Entry
SMULJ23_0559      CDS       T02086                                 

Gene name
malQ
Definition
putative 4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
smj  Streptococcus mutans LJ23
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMULJ23_0559 (malQ)
Enzymes [BR:smj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SMULJ23_0559 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
594940..596469
Genome map
AA seq 509 aa AA seqDB search
MEKRASGILMHISSLPGKFGIGTFGQEAYDFVDFLKKTGQTYWQLLPLTTTSYGDSPYQS
FSAVAGNVNFIDFKKLQEAGLLDEDDYNSVSFGEDEEIVDYALLFKVRRPILEKAVINFL
ADKTNLKKLALFEEKNETWLDDYAEFMAIKEHFGNKSLQEWGDKKAIRRDEERLVRYRHL
LADEISYHKVTQYFFFEQWLALKAYANKNKIKIIGDMPIYVAKDSVEVWTMPELFKMDDD
LQPLSVAGCPPDEFSDEGQLWGNPIYDWKKHRETGFAWWIYRIQESFKIYDILRIDHFKG
FSDYWEIKGNSKTAKNGSWHPGPGIALFRAVQNVLGDMPIIAEDLGYVDDRARQLLKETG
FPGMKILEFGFYDLSGRSVDIPHHYVQNSVAYIGTHDNDVVNGWYDRLTVEQEEFVDAYT
NRKPIEPVNQAMLRLLFSTVSNTAILTMQDLLNKPASSRMNTPSTIGGNWQWRMRAKDLT
QDKIDFLSKLTKLYQRGNEENDTKNKTIQ
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacgcgcaagtggtatcctgatgcatatcagttctctaccgggaaaatttgga
attggtacttttgggcaggaagcttatgattttgttgatttcctaaaaaaaacaggtcaa
acatattggcagctcttacccttaacgacaacgagttatggtgattctccttaccaatct
ttttctgccgttgctggtaatgtgaattttattgattttaagaaattacaagaagctggc
ttattggacgaggatgactataattctgtttcttttggagaagacgaagaaattgttgat
tatgctctattatttaaagtacgtcggccaattttggaaaaggctgttatcaattttctg
gcagacaagactaatctgaaaaaattagctttgtttgaagaaaaaaatgaaacttggctt
gatgactatgctgaatttatggctatcaaggagcattttggcaataagtctttgcaagag
tggggcgataaaaaggctattcgccgtgatgaggagcgtttggtacgttatcgtcatttg
ttggccgatgaaattagctaccataaggttacacagtacttcttcttcgaacaatggctg
gcgctgaaagcttatgctaataaaaataagatcaaaattattggcgatatgcctatctat
gtagctaaagacagtgttgaagtctggactatgcctgaactctttaagatggatgatgac
ttgcagcctttgtcggttgctggctgtccgcccgatgaatttagtgatgagggtcagttg
tggggaaatcctatttatgattggaaaaagcatcgagaaacaggctttgcttggtggatt
tatcgtattcaagaaagttttaagatctatgatatcttacggatagatcactttaaaggt
ttctcagattattgggaaattaaaggtaattccaaaactgcaaaaaatggcagctggcat
ccaggacctggtattgctctctttagggctgttcaaaatgttttgggcgatatgccaatt
attgcagaggatttgggttacgtagatgatagagccagacagcttctaaaagaaacaggc
tttccaggcatgaaaattttagaatttggtttctatgatttaagcggccgcagtgttgat
attccccaccattatgttcaaaatagtgttgcttatattgggacgcatgataatgatgtt
gtcaatggttggtatgatcgtcttactgttgagcaagaagaatttgtggatgcttatact
aatcgtaagccaattgagccggttaatcaggctatgcttagactgctcttttcaactgtc
agcaatacagctattttaaccatgcaggatttgctcaataagccagccagctctagaatg
aataccccatcaacaatcggtggtaactggcaatggcggatgagagcaaaagatttaaca
caagataaaatagactttttaagtaaattaacgaaactttatcaaagaggaaatgaagaa
aatgacacaaaaaacaaaacaattcagtaa

DBGET integrated database retrieval system