KEGG   Streptococcus mutans LJ23: SMULJ23_0581Help
Entry
SMULJ23_0581      CDS       T02086                                 

Gene name
glgB
Definition
putative 1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
smj  Streptococcus mutans LJ23
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smj00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
619017..620903
Genome map
AA seq 628 aa AA seqDB search
MNEREALRTFGTGENFHAQHYFGFHETEKNGVKGYIFRVWAPNAEDLHLIGDFTGWFDNP
LQMDKNEAGVWEVFTDLPKEGHIYKYLVKRQGGQIVEKMDPFAIYLEERPGTGSLIRTIP
EKKWKDGLWLGRRKRWGFFKRPVNIYEVHAGSWKQNEDGSPYSFEQLKDELVPYLVKMNY
THVEFMPLMAHPLGMSWGYQLMGFFAFEHTYGTPEQFQDFVEACHLNNIGVIVDWVPGHF
TQNDDALAYFDGTPTFEYQDHDRAHNYRWGALNFDLGKNQVQSFLISSAKFWIDFYHIDG
IRVDAVSNMLYLDYDEGPWQPNIEGNNRNLEGYYFLQRLNTVLKLAHPDVMMIAEESTAT
TKITGRREEGGLGFDYKWNMGWMNDILKFYEEDPIYRKYDFNLVTFSFMYLFSENFILPF
SHDEVVHGKKSLMHKMWGDRYNQFAGLRNLYTYQICHPGKKLLFMGSEFGQFLEWKYDHA
LEWTNLEEEDGLNLKMQDFTSQLNQFYKDHKVLWQLDTSYDGLEIIDADNVDESVLSFIR
KNEKGDLLVCVFNMVPVERKGFTIGVPVAGIYEEVWNTELEEFGGVWKEHNMTVKTQKNL
WKEYENTLSFTLPALGASIWKIKRRLKK
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagagagaagcactcagaacatttggaactggagaaaactttcatgcacaacac
tactttggatttcatgaaactgaaaaaaatggcgtaaagggttatattttcagggtttgg
gcgccaaatgctgaggatcttcatcttattggtgactttactggctggtttgataatccc
ttacaaatggataaaaatgaggcaggcgtttgggaagtctttacggatttacctaaggaa
ggccatatatataaataccttgtgaagcgacaaggtgggcaaattgttgaaaagatggat
ccatttgctatttatttggaagagcgtccgggaacgggttctctcatcagaaccattcct
gaaaagaaatggaaagatggtctttggttgggccgccgtaaacgctggggattctttaaa
aggccagtcaatatttatgaagttcatgcgggttcttggaagcaaaatgaagatggaagt
ccctatagctttgaacaattaaaggatgaattggttccttacttagtaaagatgaattat
acacatgttgaattcatgcctttgatggctcatcctttgggcatgagctggggctatcaa
ttgatgggcttctttgcctttgagcacacctatggtactccagaacagtttcaggatttt
gttgaagcttgccatcttaataatattggtgtcattgttgactgggtgcctggtcacttt
acacaaaacgatgatgctctggcttattttgatgggacaccgacctttgagtatcaggat
catgaccgtgcccataattatcgttggggagctcttaatttcgatttgggtaaaaatcaa
gttcaatctttcttgatttctagtgctaaattttggatagatttctatcatattgatggt
attcgtgttgatgctgtcagcaatatgctctatttggattatgacgaagggccttggcag
cctaacatagaaggtaacaatcgcaatctagaaggttattattttttgcagcgtttaaat
acagtgctcaaattagctcatccagatgtaatgatgattgcagaagagtcaacagctaca
actaagattacaggcaggcgtgaagaaggtggtctgggatttgactataaatggaatatg
ggttggatgaatgatattttgaaattctatgaagaagatccaatttatcgcaaatacgat
tttaaccttgtgacgtttagttttatgtatctcttttccgaaaattttatcttaccattt
tcacatgatgaagttgtgcacggcaaaaagagtctgatgcataaaatgtggggggatcgt
tataatcaatttgctggtctgagaaatttatatacttatcaaatctgccatcctggtaaa
aaattgctctttatgggaagtgaatttggccaattcttggaatggaaatatgaccatgcc
cttgagtggactaatcttgaggaagaggacggacttaatcttaaaatgcaagattttacc
agccaactcaatcaattttataaagatcataaggtactctggcaattggacaccagttat
gatggtttagaaattattgatgctgataatgttgatgaaagtgtcttgtcttttatcaga
aaaaatgagaagggagatctattagtctgtgtcttcaatatggttcctgtagaacgcaaa
ggttttacaataggcgttccggttgcgggtatatatgaagaagtatggaatactgaactt
gaggaatttggtggagtttggaaagagcacaatatgacagtcaaaacacaaaaaaatttg
tggaaggaatatgaaaatacgctcagcttcactttgccagccttgggtgctagtatttgg
aaaataaaacgtcgtttgaaaaagtaa

DBGET integrated database retrieval system