KEGG   Streptococcus mutans LJ23: SMULJ23_0781Help
Entry
SMULJ23_0781      CDS       T02086                                 

Gene name
hisD
Definition
putative histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
smj  Streptococcus mutans LJ23
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smj01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:smj00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
834416..835699
Genome map
AA seq 427 aa AA seqDB search
MKRLTGTNEEISNILYQEQLELSKENLDVEATVREIIEKVKEEGDEALRAYSEKFDHVVL
SELHVSDQVINEAFDKIDKDVLTALENAKANIESYHKQQLEGGFEDQPSQGVLRGQLIRP
IERVGVYVPGGTAAYPSSVLMNVIPAKIAGVKEIIMITPPQEHFVPAILVAAKLAGVDKI
YQVGGAQGIAALAYGTQTLPKVDKITGPGNIFVATAKKLVYGVVGIDMIAGPSEIGVIAD
STANPVYVAADLLSQAEHDVRARAILVTNSAELADAVELEIEKQLQTLPRQAIARPSIEN
NGRIIIAQDVESMFELMNLVAPEHLEIAIDKAYDYLERVQNAGSIFLGHYTSEPIGDYYT
GANHVLPTTATSRFSSALGVHDFVKRIQYTQYSKAAVNAAEKDITTLAYAEGLQAHARAI
EVRNDKN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtttaacaggaacaaatgaagagatttctaacattttatatcaagagcagctg
gaactcagcaaggaaaatttagatgttgaagcgactgttcgtgagattatcgaaaaagtc
aaagaagaaggtgatgaggctttacgagcttattctgaaaaatttgatcatgttgtatta
tccgaattgcacgtttcggatcaagttatcaatgaagcttttgacaagattgataaagat
gttctcacagcacttgaaaatgcaaaagctaatattgaatcctaccataagcaacaatta
gaaggaggttttgaagatcaaccctctcaaggggtgcttcgcggacagctgattcgtccc
attgagcgcgttggtgtctatgttcccggtggaacagcagcttatccatcatctgtactc
atgaatgttattccagctaaaattgctggtgtgaaagaaatcattatgattacaccgccg
caggaacattttgtcccagctattttggttgctgccaaactggccggtgttgataaaatt
tatcaggttggcggtgcccaaggaattgcagctttggcttatggcacacaaacactgcct
aaagtggataagattacaggcccgggcaatatctttgtagcaactgctaaaaagttggtt
tatggtgtggtaggcattgatatgattgctggaccatcggaaattggtgtcatcgcagat
agtacagccaatcctgtttatgtggctgctgatttgctgtctcaagcagaacatgatgta
cgtgcccgtgctattctcgtgactaactcagctgaattggctgatgcggttgaattagaa
attgaaaagcagttgcaaaccttgccacgtcaggctatcgctcgtccttcaattgaaaat
aatggtcgaattattattgcccaagatgtggagagcatgtttgaactcatgaatttagtg
gcgccagagcacttagaaattgctatagataaagcttatgattatttggaacgggtacaa
aatgctggttcgattttccttggacattacaccagtgaaccaattggtgattattatact
ggtgccaaccatgtgctgccgacaacagctaccagtcgtttttcatcagcacttggtgtg
catgactttgtcaaacgcatccaatacacgcaatacagtaaggctgccgttaatgcagct
gaaaaagacattacaacccttgcctatgccgaaggtttgcaggcacatgccagagcaatt
gaggtgagaaatgacaaaaactaa

DBGET integrated database retrieval system