KEGG   Streptococcus mutans LJ23: SMULJ23_1131Help
Entry
SMULJ23_1131      CDS       T02086                                 

Gene name
gtfA
Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
smj  Streptococcus mutans LJ23
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:smj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SMULJ23_1131 (gtfA)
Enzymes [BR:smj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SMULJ23_1131 (gtfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1195688..1197190)
Genome map
AA seq 500 aa AA seqDB search
MAVIFRLNWYKPKLIRGDKMPITNKTMLITYADSLGKNLKELNENIENYFGDAVGGVHLL
PFFPSTGDRGFAPIDYHEVDSAFGDWDDVKRLGEKYYLMFDFMINHISRQSKYYKDYQEK
HEASAYKDLFLNWDKFWPKNRPTQEDVDLIYKRKDRAPKQEIQFADGSVEHLWNTFGEEQ
IDLDVTKEVTMDFIRSTIENLAANGCDLIRLDAFAYAVKKLDTNDFFVEPEIWTLLDKVR
DIAAVSGAEILPEIHEHYTIQFKIADHDYYVYDFALPMVTLYSLYSGKVDRLAKWLKMSP
MKQFTTLDTHDGIGVVDVKDILTDEEITYTSNELYKVGANVNRKYSTAEYNNLDIYQINS
TYYSALGDDDQKYFLARLIQAFAPGIPQVYYVGFLAGKNDLELLESTKEGRNINRHYYSS
EEIAKEVKRPVVKALLNLFTYRNQSAAFDLDGRIEVETPNEATIVIERQNKDGSHIAKAE
INLQDMTYRVTENDQTISFE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
gtggctgttatttttaggttgaactggtataaaccaaaattaattagaggagataaaatg
ccaattacaaataaaacaatgttgattacttacgcagacagtttgggtaaaaatttgaaa
gaattgaatgaaaatattgagaattattttggagatgctgttggcggtgtccatttgctg
ccattctttccttccacaggtgatcgtggctttgcaccgattgattaccatgaagttgac
tctgcttttggcgattgggatgatgtcaaacgcttgggtgaaaaatattacctcatgttt
gatttcatgattaatcatatttcgcgtcagtctaaatattataaagattaccaagaaaag
catgaagcaagtgcttataaagatctatttttaaattgggataaattttggcctaaaaat
cgcccgacacaagaagatgtggacctgatttataagcgtaaggatcgagcacctaagcag
gaaatccaatttgcagatggcagtgttgaacatctctggaacacttttggggaggaacag
attgatcttgacgtgactaaagaagtgactatggattttattcgctctaccattgaaaat
ttagcagccaacggctgtgatctcattcgtttggatgcctttgcctatgctgttaaaaag
ctagatacgaatgatttctttgttgaacctgaaatctggactctgctagataaagttcgt
gatatagctgctgtatcgggtgcggaaatcttgccggaaattcatgaacactatactatt
caatttaaaattgcagaccatgattactatgtttatgattttgctctgcctatggtgacg
ctctacagcctatattcgggcaaggttgaccgtcttgccaaatggctgaaaatgagtccg
atgaaacagttcaccacccttgatacacatgacggtattggtgtggttgatgttaaggat
atcctgactgacgaagaaattacctatacttctaatgagctttataaggtcggtgccaat
gtcaatcgtaagtattcaactgccgaatataataacttggatatctatcaaattaattca
acttactattcagcacttggtgatgatgatcaaaaatactttttggcccgcttgatacaa
gcttttgctccaggtattccacaggtttattacgttggctttttagctggcaagaatgat
cttgaattactggaaagcactaaagaaggccgcaatatcaaccgtcattattatagtagt
gaagaaattgctaaggaagtgaagcgaccagttgtcaaggcacttttaaatctctttact
taccgcaatcagtcagcagcttttgatttggatggccgtattgaagtggaaacgccaaat
gaagcgaccattgtcatagaacgtcaaaataaagatggcagtcatatcgcaaaagcagag
attaatctccaagatatgacatacagagtaacagaaaatgatcaaacaataagctttgaa
taa

DBGET integrated database retrieval system