KEGG   Streptococcus mutans LJ23: SMULJ23_1135Help
Entry
SMULJ23_1135      CDS       T02086                                 

Gene name
agaL
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
smj  Streptococcus mutans LJ23
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:smj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SMULJ23_1135 (agaL)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SMULJ23_1135 (agaL)
   00600 Sphingolipid metabolism
    SMULJ23_1135 (agaL)
Enzymes [BR:smj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SMULJ23_1135 (agaL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1200337..1202499)
Genome map
AA seq 720 aa AA seqDB search
MGIVIKDNLFYIHTKDSSLIIEERDGDLLLKHLGKKIEAYHFSNTVFEKDHAFSANPVAD
NRNYSYDTQRQIFGVHGFGDFRVPSLILQHDNNDLTRFKFKKAKIIKGGIKARGLPNPHS
SESAQSLALILEDDLAKLRMTLYYTAYDDNATISTFVKFENLSDKPVILHRALSTMFDLP
ASHYDVITFQGAYAREKTLRRHQIEQGLFKIGSNRGASGHAQTPSLILTEHDSNEFYGEA
LALQLIYSGNFQAFVQKNQLNEVRLGIGINDDNFSWELQANQSFETPVALITYTDKGLTD
LTQESHNFIKRHIIPKNFANKERPILINNWEATYFDFNRSQLLGLADEARKLGIELFVLD
DGWFGHRFDDNSSLGDWFVNEEKLGGSLDSFIKEIHDRGLQFGLWFEPEMVSVDSKLYRA
HPDWVIQADQREHTYSRNQLVLNLANPDVVAYIKTVLDKLLTENTIDYVKWDYNRNITNI
GNGRTYLETQMQSHAYILGLYDIVSYLTTKHDKVLFESCSGGGGRNDLGMMCYFPQVWSS
DNTDAIARLPIQYGSSYLYPTISMGAHVSAVPNHQMNRHTPLTTRGHVAMMGNLGYELDL
AILTKNEKKAVANQIKHYKKIRSVVQFGKLHRLINPEVGINEVAVQYTYDNQVLVTYVRI
QSTIEMMETTVKLRGLDADAIYVLIETGQVFSGAELMYAGLTIDMPQGDYLSKQYYFIKK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgggcattgttattaaagataaccttttttatatacacaccaaagactcatcattgatt
attgaagaaagagatggtgatttgcttttaaaacatctaggtaaaaaaattgaagcctat
catttttccaatactgtttttgaaaaggatcatgctttttcagctaatccagtggcggac
aatagaaattatagttatgatacacaaagacaaatatttggtgttcatggttttggtgat
tttagagtgccttcactaatccttcaacatgataataatgatttaacacggtttaaattt
aagaaggctaaaattattaagggggggatcaaggcaagaggtttgcctaatccacatagc
agtgagagtgctcaaagcttggctcttatcttagaagatgatttggcaaaactgcgcatg
actctgtattatacggcttatgatgataatgccaccatttcaacctttgtcaaatttgaa
aatttatctgataagcctgttattcttcatcgtgctttatcaacaatgtttgatttacct
gccagccattatgatgtgataacttttcaaggagcttatgctcgcgagaagacgcttcgg
cgccaccagattgaacagggtctgtttaaaataggctctaatcgaggagcttcaggacat
gctcaaaccccttccttaattttaacagagcatgatagcaatgagttttatggagaggct
ttggctttacaattaatctatagcggaaattttcaagcttttgttcaaaaaaatcaatta
aacgaggttcgcttaggcatcggaataaatgatgataatttttcatgggaactgcaggct
aatcagagttttgagacacctgtagctttgataacctacactgataagggattaacggat
ctgacacaagaaagtcataattttattaaacgtcatattattcctaagaattttgctaat
aaggaacgtcctatccttatcaataattgggaggcaacatattttgattttaatcggagt
caattgctggggctggcagatgaagccagaaaacttggcattgaactctttgtgcttgac
gatggttggtttggtcatcgttttgatgacaatagctcacttggtgattggtttgtcaat
gaagaaaaacttgggggttcccttgatagctttatcaaggaaattcatgatagaggatta
cagtttggcctttggtttgaaccagaaatggtatcagttgacagcaaactttatagagct
catcctgattgggtcattcaggcagatcagcgagagcatacttattctcgcaatcaattg
gtcttgaatctagctaatcccgatgtagttgcttatatcaaaactgttcttgataagctg
ctgacagaaaatacgattgattatgttaaatgggactacaatcgcaatataaccaatatt
ggcaatggcagaacttacttggaaacgcaaatgcagtcgcatgcttatatactggggttg
tatgatattgtttcttacttaacaacaaaacacgataaggtcttgtttgaatcctgttca
ggaggtggcggtcgcaacgatttggggatgatgtgttattttcctcaagtgtggtcaagt
gataatacagatgctattgcaagactgcctatacagtatggttcctcttatctttaccca
actatttctatgggagctcatgtttcagcggttcctaaccatcaaatgaaccgtcatacc
cctcttacaacacgaggtcatgttgctatgatgggaaatttaggttatgaattggactta
gcaatcttaaccaaaaatgaaaaaaaggctgttgccaatcagattaaacattataaaaag
ataaggtctgttgtacaatttggtaagcttcaccgtctaattaatcccgaagttggaatt
aatgaggtagcagtgcaatatacctatgacaatcaggtactggttacctatgtccgtatt
caatcaaccatagagatgatggaaacaactgtaaagttgaggggactagatgcagatgcc
atttatgttcttatagaaactggacaagtcttttcaggtgcggagttaatgtatgcggga
ttgaccattgatatgccgcaaggtgattatttgagtaaacaatactattttattaaaaag
tag

DBGET integrated database retrieval system