KEGG   Streptococcus mutans LJ23: SMULJ23_1536Help
Entry
SMULJ23_1536      CDS       T02086                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
smj  Streptococcus mutans LJ23
Pathway
smj00330  Arginine and proline metabolism
smj00332  Carbapenem biosynthesis
smj01100  Metabolic pathways
smj01130  Biosynthesis of antibiotics
smj01230  Biosynthesis of amino acids
Module
smj_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:smj00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SMULJ23_1536 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SMULJ23_1536 (proB)
Enzymes [BR:smj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SMULJ23_1536 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: BAL69870
Position
complement(1621848..1622657)
Genome map
AA seq 269 aa AA seqDB search
MNHMKRNFEHVKRIVIKIGTSSLVLPSGKIDLNKIDQLAFVISNLMNRELDVILVSSGAM
GFGLDILKMDKRPAEVARQQAVSSVGQVAMMSLYSQIFSHYQTNVSQILLTRDVVEFPES
LENVTNTFETLLSMRIVPIVNENDAISVDEMDHTTKFGDNDRLSALVANITNSDLLIMLS
DIDGLFDKNPTIYDNAVLRENVTEITEEILKSAGGAGSKFGTGGMMSKIKSAQMIFDCDR
QMILMNGANPRDILRALDGKMIGTLFAKE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatatgaaacgaaattttgaacatgtcaagcgaattgttataaaaatcggaacc
agttcgcttgttttaccaagtggaaagattgatttgaataaaatagatcagctggctttt
gttatttcaaacttgatgaatagagaacttgatgttattttagtttcatctggtgcaatg
ggatttggactagatatcttgaaaatggataagcgtccagccgaggttgctcgccagcag
gctgtttccagcgtcggtcaagtagctatgatgagcctttattctcaaatcttttcgcac
tatcaaaccaatgtttctcagattcttttaacaagagatgttgttgaatttcctgaaagt
cttgaaaatgtgaccaatacttttgagacccttttatctatgagaattgtgcctattgtt
aatgaaaatgatgccatcagtgtggatgagatggatcatacaactaagtttggcgataat
gatcgcttgtcagctctagttgcaaatattacaaatagtgaccttttaattatgttatct
gatattgatggtctttttgataaaaatccaactatttatgataatgcagttttgagagaa
aatgtaactgaaattaccgaggaaattcttaaatcagcaggtggtgcaggtagtaagttt
gggacaggcggcatgatgagcaaaatcaaaagtgctcagatgatttttgactgtgaccgt
caaatgattctgatgaacggtgccaatccccgtgatattttacgggctcttgatggaaaa
atgataggaaccttatttgcaaaggagtag

DBGET integrated database retrieval system