KEGG   Sinorhizobium meliloti AK83: Sinme_0300Help
Entry
Sinme_0300        CDS       T01521                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00340  Histidine metabolism
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Sinme_0300
Enzymes [BR:smk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Sinme_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEG52067
JGI: Sinme_0300
Position
1:316001..317305
Genome map
AA seq 434 aa AA seqDB search
MAIRLNYLDTSFERDFAAFLTTKREVSEDVNAVVRAIIDDVRARGDAALADYSARFDGID
FTVTGMAVTSAEIDAAIHAVAPEVLGALKVAATRIEAHHRRQLPKDDIYEDQMGVGLGSR
WTPIDAVGLYVPGGTASYPSSVLMNALPAKVAGVPRIVMVVPASGGSINPAVLAAARLAG
VEEIYRIGGAQAVAALAYGTETIEPVAKIVGPGNAYVAAAKRQVFGTVGIDMIAGPSEVL
VIADRDNDPDWIAADLLAQAEHDAGAQAILITDDAAFGDAVEKAVERQLKTLPRAETAAA
SWRDFGAVILVPDFDKAVPLANRIAPEHLELATADPDAMVPAIRNAGAIFIGRHTPEVIG
DYVGGSNHVLPTARSARFSSGLGVLDYVKRTSILRLGPDQLRILGPAAIALARSEGLEAH
ARSVAIRLNLGEEG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttggcaatcaggctgaactatctcgatacgagctttgagcgcgatttcgccgcgttcctg
acgaccaaacgggaagtttccgaagacgtcaacgccgtcgtgcgcgccatcatcgacgat
gtccgcgcccgcggagatgcggcgctcgccgactattccgcgcgtttcgacgggatcgac
tttactgtaaccggcatggcggtgacgtcggcggaaatagacgcggcgatccacgcggtc
gctccggaagtactcggcgcattgaaggtcgcggcgacccgcatcgaggcgcatcaccgg
cggcaattgccgaaggacgacatttacgaagaccagatgggcgtcggcctcggctcgcgc
tggacaccgatcgacgcagtcggtctctatgtgccgggcggcacggcgagctatccgagc
tcggttctgatgaacgccctgccggccaaggtcgcaggcgtgccgcgcatcgtcatggtc
gtgccggccagcggcgggtcgatcaatccggcggtgctcgcggccgcccgcctcgccggc
gtcgaggagatctaccgcatcggcggcgcgcaggccgtggcggcgctcgcttacggcacc
gagacgatcgagccggtggcgaagatcgtcggccctggaaatgcctatgtcgcggccgcc
aagcggcaggttttcggcaccgtcggcatcgacatgatcgccgggccgtcggaagtgctg
gtgatcgcggaccgcgacaacgatccggattggatcgccgcggacctgctcgcccaggcc
gagcacgacgccggcgcgcaggcaatcctgatcaccgacgatgccgccttcggcgacgcg
gtcgaaaaggcggtggagcgtcagctgaagacgctgccgcgcgccgagacggcggcagcg
agctggcgcgatttcggcgccgtgatcctggttccggatttcgacaaggccgtgccgctc
gccaaccgcatcgccccggaacatctcgagctggcgaccgccgatcccgacgcgatggtc
cccgcgatccgcaatgccggtgcgatcttcatcggcaggcacacacccgaagtcatcggc
gattatgtgggcgggtccaaccacgtgctgccgacggcgcgttcggcgcggttctcctcc
ggcctcggcgtgctcgactatgtgaagcgaacctcgatcctgcggctcggcccggatcag
ttgcgcattctcgggcccgccgcgatcgcgctggcgagatcggaaggcctcgaggcccat
gcccggtcggtcgccatccgcctcaatctcggggaagagggatga

DBGET integrated database retrieval system