KEGG   Sinorhizobium meliloti AK83: Sinme_0335Help
Entry
Sinme_0335        CDS       T01521                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:smk02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:smk02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:344242..345291
Genome map
AA seq 349 aa AA seqDB search
MSAPARVLVVDDSATMRGLISAVLNADPDITVVGQAADALEARQAIKQLDPDVVTLDIEM
PNMNGLEFLDKIMRLRPMPVIMVSTLTHRGAEATIAALEIGAFDCVGKPQPGDTHPFRDL
ADKVKAAARSQRKSMITSNRAAAPAATAVSDYRAGRKIVAIGASTGGVEALITVLQKFPA
NCPPTVITQHMPHTFTKSFAERLNRLCAPTVQEATDGARLEVGRVYLAPGGERHLEVHNA
AAPCCRLVDHPPVNGHRPSVDVLFDSVAELAGRNAIGVILTGMGRDGAAGLLKLRHAGAR
TFGQNEKTCVVYGMPRVAYELGAVETQLPLGSIGEEILKTAAARKEGIE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcccgcacgtgttctcgtcgtagacgactcggccaccatgcgcggcctcatc
tccgccgtgctcaatgccgatccggacattacggtcgtcggtcaggctgccgatgcgctc
gaggcgcgtcaggcgatcaagcagctcgaccccgatgtcgtgaccctcgacatcgagatg
ccgaacatgaacggcctcgaattcctcgacaagatcatgcggctgaggcccatgccggtg
atcatggtctcgacgctgacccataggggcgccgaagcgacgatcgccgcgctcgagatc
ggcgccttcgactgcgtcggcaagccccagccaggggatacgcatccgttccgcgatctc
gccgacaaggtcaaggcggccgcgcgttcgcagcgcaagtccatgatcaccagcaacagg
gcggccgcgccggcggcgacagccgtttccgactaccgggcagggcgcaagatcgtcgcg
atcggagcctcgaccggcggggtcgaggcgctgatcacggtcttgcagaagttccccgcg
aattgcccgccgacggtgatcacgcagcacatgccgcacaccttcaccaagagcttcgcc
gaacggctgaaccggctttgcgccccgacggtccaggaggcgacggatggcgcgcggctc
gaggtcggcagggtctatctggcgcccggcggcgaacgccatcttgaggtccataatgcc
gcagcaccctgctgccgactggtggatcatccgccggtcaacggacatcgtccctcggtc
gacgtgctgttcgattccgtcgccgaactggcgggccggaacgccatcggggtgattctc
accggaatgggccgcgatggcgccgccggtctcctgaaattgcggcatgccggagcacgc
accttcggtcagaacgaaaagacctgtgtcgtctacggcatgccgcgcgtcgcctatgaa
ttgggcgcggtcgaaacgcagctccccctcggatcgatcggggaggagattttgaagacg
gcggctgcccgaaaagaaggaatcgaataa

DBGET integrated database retrieval system