KEGG   Sinorhizobium meliloti AK83: Sinme_0335Help
Entry
Sinme_0335        CDS       T01521                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:smk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sinme_0335
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sinme_0335
Enzymes [BR:smk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sinme_0335
Two-component system [BR:smk02022]
 CheA family
  CheA-CheYBV
   Sinme_0335
Bacterial motility proteins [BR:smk02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sinme_0335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:344242..345291
Genome map
AA seq 349 aa AA seqDB search
MSAPARVLVVDDSATMRGLISAVLNADPDITVVGQAADALEARQAIKQLDPDVVTLDIEM
PNMNGLEFLDKIMRLRPMPVIMVSTLTHRGAEATIAALEIGAFDCVGKPQPGDTHPFRDL
ADKVKAAARSQRKSMITSNRAAAPAATAVSDYRAGRKIVAIGASTGGVEALITVLQKFPA
NCPPTVITQHMPHTFTKSFAERLNRLCAPTVQEATDGARLEVGRVYLAPGGERHLEVHNA
AAPCCRLVDHPPVNGHRPSVDVLFDSVAELAGRNAIGVILTGMGRDGAAGLLKLRHAGAR
TFGQNEKTCVVYGMPRVAYELGAVETQLPLGSIGEEILKTAAARKEGIE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcccgcacgtgttctcgtcgtagacgactcggccaccatgcgcggcctcatc
tccgccgtgctcaatgccgatccggacattacggtcgtcggtcaggctgccgatgcgctc
gaggcgcgtcaggcgatcaagcagctcgaccccgatgtcgtgaccctcgacatcgagatg
ccgaacatgaacggcctcgaattcctcgacaagatcatgcggctgaggcccatgccggtg
atcatggtctcgacgctgacccataggggcgccgaagcgacgatcgccgcgctcgagatc
ggcgccttcgactgcgtcggcaagccccagccaggggatacgcatccgttccgcgatctc
gccgacaaggtcaaggcggccgcgcgttcgcagcgcaagtccatgatcaccagcaacagg
gcggccgcgccggcggcgacagccgtttccgactaccgggcagggcgcaagatcgtcgcg
atcggagcctcgaccggcggggtcgaggcgctgatcacggtcttgcagaagttccccgcg
aattgcccgccgacggtgatcacgcagcacatgccgcacaccttcaccaagagcttcgcc
gaacggctgaaccggctttgcgccccgacggtccaggaggcgacggatggcgcgcggctc
gaggtcggcagggtctatctggcgcccggcggcgaacgccatcttgaggtccataatgcc
gcagcaccctgctgccgactggtggatcatccgccggtcaacggacatcgtccctcggtc
gacgtgctgttcgattccgtcgccgaactggcgggccggaacgccatcggggtgattctc
accggaatgggccgcgatggcgccgccggtctcctgaaattgcggcatgccggagcacgc
accttcggtcagaacgaaaagacctgtgtcgtctacggcatgccgcgcgtcgcctatgaa
ttgggcgcggtcgaaacgcagctccccctcggatcgatcggggaggagattttgaagacg
gcggctgcccgaaaagaaggaatcgaataa

DBGET integrated database retrieval system