KEGG   Sinorhizobium meliloti AK83: Sinme_0629Help
Entry
Sinme_0629        CDS       T01521                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00260  Glycine, serine and threonine metabolism
smk00750  Vitamin B6 metabolism
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01120  Microbial metabolism in diverse environments
smk01230  Biosynthesis of amino acids
Module
smk_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sinme_0629
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sinme_0629
Enzymes [BR:smk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sinme_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEG52390
JGI: Sinme_0629
Position
1:complement(655657..657057)
Genome map
AA seq 466 aa AA seqDB search
MVKYISTRGEAASLGFCDALLAGLARDGGLYLPKEWPALSKKEIRALRGKSYQEIAFTVL
EPFTNGEIPAAKFREMIDEAYATFRHPAVAPLVQTGPNAFVMELFHGSTLAFKDVAMQLL
ARLMDYVLAERGERATIVGATSGDTGGAAIDAFAGRDRTDIFILFPQGKVSPVQQRQMTT
STASNVHAVAVKGNFDDCQNLVKAMFNDQAFRDRVKLSGVNSINWARIMAQIVYYFTTAV
ALGAPDRKISFTVPTGNFGDIFAGYVAKRMGLPIDKLIIATNENDILARTLKNGRYEMRD
VKATTSPSMDIQISSNFERLIFEANERDPAEVRAAMASLRQSGSFTIGDAALKKIRKEFR
AGRASEKDVAKTIRKTFDETGYLLDPHTAIGVFVATKHEKNSAPMVTLATAHPAKFPAAV
KSASGIDPTLPTWLADLMTRAERFDILDPELKSVETFIGERTRVRE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagtatatttcgacacggggagaagcggcctctctcggcttttgcgatgctctt
ctggcgggacttgcccgcgacggcgggctttacctgccgaaggaatggccggcactctcg
aagaaggagatccgggcgctgcgcggcaaatcctatcaggagatcgccttcaccgttctc
gaacccttcaccaatggcgagatcccggcggccaagttccgcgagatgatcgacgaggcc
tatgccactttccgtcatccggccgtagcacccctggtccagaccggaccgaacgctttc
gtgatggagctctttcacggttcgacgctcgccttcaaggacgtcgccatgcagttgctc
gcccggctgatggactatgttcttgccgaacggggcgagcgggcgacgatcgtgggagcg
acatcaggcgataccggcggtgccgcgatcgacgccttcgccggccgcgaccgcaccgac
atcttcatcctctttccgcagggcaaagtgtcgccggtgcagcaaagacagatgaccacg
tccacggcatcgaacgtgcacgcggttgccgtcaaaggcaatttcgacgactgccagaac
ctggtcaaagccatgttcaacgaccaggccttccgcgaccgcgtgaagctttccggcgtc
aattcgatcaactgggcgcgcatcatggcccagatcgtctactatttcacgacggcggtc
gctctcggcgcgcccgaccggaagatctccttcaccgtgcctaccggcaatttcggcgat
attttcgcaggctacgtcgccaagcgcatgggtctgccgatcgacaagctgatcatcgcc
accaacgaaaacgacattctggcgcgcacgctgaagaacggccgctacgagatgcgcgac
gtcaaggcgacgacctcgccttcgatggacatccagatctcgtcgaacttcgaaaggctc
atcttcgaggcgaacgagcgcgatccggcggaagtccgcgcggccatggcgagcctcagg
caatccggctcgttcacgatcggcgacgcagcgctgaaaaaaatccgcaaggaatttcgc
gccggccgcgcctcggagaaagatgtggcgaaaacgatccgcaagaccttcgacgagacc
ggctatctccttgatccgcatacggcaatcggcgttttcgtggcaaccaagcacgagaag
aactccgccccgatggtcacccttgcgactgcccatccggcaaaatttcccgccgcagta
aaatcggcaagtggtattgaccccacgcttccgacgtggcttgctgatctcatgactagg
gcggagcgtttcgacatcctggatccggagctcaagagcgtcgaaaccttcatcggcgag
cgtacccgcgttcgggaatag

DBGET integrated database retrieval system