KEGG   Sinorhizobium meliloti AK83: Sinme_0629Help
Entry
Sinme_0629        CDS       T01521                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sinme_0629
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sinme_0629
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sinme_0629
Enzymes [BR:smk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sinme_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
1:complement(655657..657057)
Genome map
AA seq 466 aa AA seqDB search
MVKYISTRGEAASLGFCDALLAGLARDGGLYLPKEWPALSKKEIRALRGKSYQEIAFTVL
EPFTNGEIPAAKFREMIDEAYATFRHPAVAPLVQTGPNAFVMELFHGSTLAFKDVAMQLL
ARLMDYVLAERGERATIVGATSGDTGGAAIDAFAGRDRTDIFILFPQGKVSPVQQRQMTT
STASNVHAVAVKGNFDDCQNLVKAMFNDQAFRDRVKLSGVNSINWARIMAQIVYYFTTAV
ALGAPDRKISFTVPTGNFGDIFAGYVAKRMGLPIDKLIIATNENDILARTLKNGRYEMRD
VKATTSPSMDIQISSNFERLIFEANERDPAEVRAAMASLRQSGSFTIGDAALKKIRKEFR
AGRASEKDVAKTIRKTFDETGYLLDPHTAIGVFVATKHEKNSAPMVTLATAHPAKFPAAV
KSASGIDPTLPTWLADLMTRAERFDILDPELKSVETFIGERTRVRE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagtatatttcgacacggggagaagcggcctctctcggcttttgcgatgctctt
ctggcgggacttgcccgcgacggcgggctttacctgccgaaggaatggccggcactctcg
aagaaggagatccgggcgctgcgcggcaaatcctatcaggagatcgccttcaccgttctc
gaacccttcaccaatggcgagatcccggcggccaagttccgcgagatgatcgacgaggcc
tatgccactttccgtcatccggccgtagcacccctggtccagaccggaccgaacgctttc
gtgatggagctctttcacggttcgacgctcgccttcaaggacgtcgccatgcagttgctc
gcccggctgatggactatgttcttgccgaacggggcgagcgggcgacgatcgtgggagcg
acatcaggcgataccggcggtgccgcgatcgacgccttcgccggccgcgaccgcaccgac
atcttcatcctctttccgcagggcaaagtgtcgccggtgcagcaaagacagatgaccacg
tccacggcatcgaacgtgcacgcggttgccgtcaaaggcaatttcgacgactgccagaac
ctggtcaaagccatgttcaacgaccaggccttccgcgaccgcgtgaagctttccggcgtc
aattcgatcaactgggcgcgcatcatggcccagatcgtctactatttcacgacggcggtc
gctctcggcgcgcccgaccggaagatctccttcaccgtgcctaccggcaatttcggcgat
attttcgcaggctacgtcgccaagcgcatgggtctgccgatcgacaagctgatcatcgcc
accaacgaaaacgacattctggcgcgcacgctgaagaacggccgctacgagatgcgcgac
gtcaaggcgacgacctcgccttcgatggacatccagatctcgtcgaacttcgaaaggctc
atcttcgaggcgaacgagcgcgatccggcggaagtccgcgcggccatggcgagcctcagg
caatccggctcgttcacgatcggcgacgcagcgctgaaaaaaatccgcaaggaatttcgc
gccggccgcgcctcggagaaagatgtggcgaaaacgatccgcaagaccttcgacgagacc
ggctatctccttgatccgcatacggcaatcggcgttttcgtggcaaccaagcacgagaag
aactccgccccgatggtcacccttgcgactgcccatccggcaaaatttcccgccgcagta
aaatcggcaagtggtattgaccccacgcttccgacgtggcttgctgatctcatgactagg
gcggagcgtttcgacatcctggatccggagctcaagagcgtcgaaaccttcatcggcgag
cgtacccgcgttcgggaatag

DBGET integrated database retrieval system