KEGG   Sinorhizobium meliloti AK83: Sinme_1220Help
Entry
Sinme_1220        CDS       T01521                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smk00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1233337..1233951)
Genome map
AA seq 204 aa AA seqDB search
MDAIVKNFPVLDDTGRPTQKEAEEAVRVLLRWAGEDPAREGLKDTPSRVAKAYREIFGGY
DLVAEDVLGRTFEEVSGYDDIVLEKDIPFYSHCEHHMVPIIGKAHIAYLPNGRVLGLSKI
ARVVDIYARRLQTQEAMTAQIAKAIDETLMPRGVAVMIEAEHLCMAMRGIKKQGATTLTT
TFTGAFKSEPAEQVRFMTMLRGFK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatagtgaagaattttcctgtgctcgacgacacaggtcgtccgacgcagaag
gaagccgaagaagccgttcgcgtcttgttgcgctgggcaggtgaagatccggcacgagaa
ggcctgaaggacacgccttcgcgtgtcgccaaggcgtatcgggaaattttcggcggctac
gatctcgtggcggaagacgtgctcgggcgaaccttcgaggaagtctccggctacgacgat
atcgtgctcgaaaaggacatcccgttctattcgcattgcgagcaccacatggtgccgatc
atcggcaaggcccatatcgcctatctgccgaacggccgcgtgctcggcctttccaagatc
gcccgggtcgtcgatatctacgcccgtcgcctgcagacgcaggaagcgatgacggcgcag
atcgcaaaggccatcgacgagaccctcatgccccggggcgtggcggtgatgatcgaggcc
gagcacctgtgcatggcgatgcgcggtatcaagaagcagggcgcgacgacgctgacgacc
accttcaccggtgcgttcaagagcgagccggccgaacaggtccgcttcatgacgatgctc
aggggcttcaagtaa

DBGET integrated database retrieval system