KEGG   Sinorhizobium meliloti AK83: Sinme_1327Help
Entry
Sinme_1327        CDS       T01521                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sinme_1327
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Sinme_1327
Enzymes [BR:smk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sinme_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1349771..1350805
Genome map
AA seq 344 aa AA seqDB search
MQYAFRMSESKAFISGCKGLTLTQEERDFFAGERPWGFILFGRNIGEEEQIRDLVASLRE
SIGSPQAPVLIDQEGGRVQRIRPPLVQQYPNGAAIGEIYRRDRELGLRAAWLMGRLHAFD
LMRFGITVDCLPVLDVPVPGSHDVIGNRAYGHDPATVTAIGRAMSEGLKAGGMLPVMKHM
PGHGRTFVDSHHNLPVVSAGLDELKSSDFLPFAAMKDEAMAMSAHMVFTAIDPDNPATTS
AKVVREIIRGHIGFDGLLMSDDVSMNALAGDMTARAGGIIAAGLDLVLHCHGIMEEMKAV
ADVVPVLSGERLRRARAAEAAFREPDDAVEAALRAEFNAMFALA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgcttttcgcatgagcgaatcaaaagcattcatatccggctgcaagggcctc
acgctgacgcaggaagaacgcgacttctttgcgggcgagcgcccatggggcttcattctc
ttcggacgcaatatcggcgaggaagagcagatccgcgacctggtggcgagcctgcgtgag
agcatcggcagcccccaggccccggtattgatcgatcaggagggcggtcgcgttcagcgc
atacgcccgccgctcgtgcagcaatatccgaacggcgcggcgatcggcgaaatctatcgg
cgggacagggaactcggcctgcgtgccgcatggctcatggggcgcctgcatgccttcgac
ctgatgcgcttcggcattacggtcgattgcctgccggtactcgatgtgccggtacccggc
agccatgacgtgatcggcaatcgtgcctacgggcatgacccggcgacggtaaccgcgatc
ggtcgcgcgatgagcgaaggtttgaaggcgggcggcatgctgccggtgatgaagcacatg
cccggtcacggccggaccttcgtcgactcgcatcacaacctgccggtcgtcagcgccggt
ctcgatgagttgaagagcagcgattttctgcccttcgcggcaatgaaggacgaagcgatg
gccatgtcggcgcacatggtcttcactgctatcgacccggacaacccggcgacgacctct
gcgaaagttgtgcgcgagatcatccggggccacatcggcttcgacggtctgctgatgtcc
gatgacgtctccatgaatgcgcttgccggcgacatgacggcacgtgccggcggaataatc
gccgccggtcttgatctcgtcttgcattgtcacggcattatggaagaaatgaaggccgtg
gcagatgtcgttccggttctctccggggagaggctccgccgggcgagggctgccgaggcc
gctttccgggaaccggacgacgcagtcgaagctgcactgcgcgcggagttcaacgcaatg
tttgcgctcgcctag

DBGET integrated database retrieval system