KEGG   Sinorhizobium meliloti AK83: Sinme_1565Help
Entry
Sinme_1565        CDS       T01521                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sinme_1565
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinme_1565
Enzymes [BR:smk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sinme_1565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1570481..1571296
Genome map
AA seq 271 aa AA seqDB search
MTDILRRIEAYKREEIAAAKARVPLEELKARAADQSAPRGFHAALAARRDKGEFGLIAEI
KKASPSKGLIRPDFDPPELAKAYAAGGAACLSVLTDAPSFQGAPEFLTKAREACPLPALR
KDFMFDTYQVFEARAWGADCILLIMASLGDNDARRLEEAAFALGMDVLVEVHDAEEMERA
LRLSSPLVGINNRNLRTFEVDLAVSERLAAMVSADRLLVGESGVFTHEDCRRLEKSGITT
FLVGESLMRKDDVEAATRALLTGSASIMAAE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacggatatcctgcgccgcatcgaagcctataagcgagaggagatcgccgccgcgaaa
gcgcgcgttccgctcgaagagttgaaggcgcgggccgccgatcagtccgcgccgcgcggt
ttccacgccgcgcttgcggcccggcgggacaaaggcgagttcgggctgatcgccgaaatc
aagaaggcgagcccctcgaagggtttgatccgcccggatttcgatcctccggaactggcg
aaggcctatgccgcgggcggcgccgcctgcctctccgtccttaccgacgcgccgagcttc
cagggtgcgccggagttcctgacgaaggcacgcgaggcctgcccgctcccggctctgcgc
aaggacttcatgttcgacacctatcaggttttcgaagcgcgcgcctggggcgccgattgc
attctgctgatcatggcctcgcttggcgacaatgatgcgcgccggctggaagaagccgca
tttgcactcggcatggatgtcctcgtcgaagtacacgacgcggaagagatggaacgagca
cttcgcctgtcatctccgctcgtcgggatcaacaaccgcaatctcaggacgttcgaggtc
gatctcgccgtctccgaaaggctcgcggcaatggtttccgcagaccgtctcctggtcggc
gaaagcggcgtattcacgcacgaagactgccggcgcctagagaagagcgggattaccacc
ttcctggtcggtgaaagcctgatgaggaaggacgacgtagaggcggcgacgcgtgcgctg
ctgaccggctcggcaagcatcatggcggcagagtga

DBGET integrated database retrieval system