KEGG   Sinorhizobium meliloti AK83: Sinme_1716Help
Entry
Sinme_1716        CDS       T01521                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00790  Folate biosynthesis
smk01100  Metabolic pathways
Module
smk_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sinme_1716
Enzymes [BR:smk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Sinme_1716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind BKACE
Motif
Other DBs
NCBI-ProteinID: AEG53451
JGI: Sinme_1716
Position
1:complement(1727600..1728451)
Genome map
AA seq 283 aa AA seqDB search
MTYDPFQPSRWHLAHGRDLELGPRGVLMAIINVTPDSFSDGGRFADPDAAVRAALRALEA
GAEILDIGGESTRPDAKPVSADEEQARILPVIAAIARQSQVVISVDTYRAETARLAVDAG
AHIVNDVYGLQREPAIATVAAETGAGLCIMHTGRDREKLSDVIEDQFHFLERSLQIAADA
GVAREGIVLDPGFGFAKDTNENLELMARFRALHEFRRPLLVGTSRKRFVGAVTGREAGGR
DVGTAATTALLRTAGAAIFRVHDVAINRDALAVADAMLAAKNS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacatacgatccatttcagccttctcgctggcatttggcgcatggacgcgatctcgaa
ctgggcccgcgtggcgttttgatggcgatcatcaatgttacaccggattcattttccgat
ggtgggcgattcgctgatcctgacgctgctgtcagagccgcgctgcgcgcactggaggcg
ggcgcggaaatcctggatattggcggcgaatccacgcgcccggacgccaaaccggtcagc
gccgacgaggaacaggcccgcatcctgcccgttatcgcggcgatcgcgcggcagtcccag
gtcgtcatttcggtcgatacttaccgcgcggaaaccgcccgtttggcggttgacgccggc
gcccacatcgtcaacgacgtgtacgggctccagcgcgagccggcgatcgcgaccgtggcg
gccgaaacgggcgccgggctctgcatcatgcataccgggcgcgaccgggagaaactgagc
gatgtgatcgaggatcagttccatttcctggaacgttccctgcagatcgccgccgacgcc
ggcgtagcgcgggaagggatcgtgctcgatccgggcttcgggttcgcgaaggacacgaac
gagaacctagagctgatggcacgcttccgggcgttgcatgagtttcgacggccgcttctc
gtcggaacgtcgcgcaagcgcttcgtcggcgcggtgaccggccgggaggcgggaggccgc
gacgtcggtaccgccgcgacgacggcgctcctcagaactgccggcgctgctatttttcgg
gtacatgatgtcgcaatcaacagggatgcgttagcggtggccgatgctatgctggccgca
aagaacagctga

DBGET integrated database retrieval system