KEGG   Sinorhizobium meliloti AK83: Sinme_2104Help
Entry
Sinme_2104        CDS       T01521                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:smk00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:smk00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2101932..2102495)
Genome map
AA seq 187 aa AA seqDB search
MTEAEQKMTTRPKIVFVVAVAANGIIGREGDLPWRLSTDLKRFKALTIGKPVVMGRKTWA
SLGRPLPGRPNIVISRNPDFEAPGAEVAPSLETALTIARERAAAVGADEICIIGGGEIYR
QSIGMADVLHVTEVQAEVDGDTRFPSIDPATFEKVMEEDLPRSEKDSHAMHFVTWRRRTP
PPEGAGA
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggcggagcagaagatgacgacccgaccgaagatcgttttcgtcgtcgctgtc
gcggcgaatggaataatcggccgcgagggcgatctgccctggcggctttcgaccgatctc
aagcgcttcaaggcgctgacgatcggcaagccggtcgtcatgggacggaagacctgggcc
tcgctcgggcggcccttgcccggcaggccgaacatcgtcatcagccgcaaccccgatttc
gaggctcccggcgcggaggtggcgccgtcgcttgaaacggcgctcacgatcgcgcgggag
cgggcggccgcggtcggggccgacgagatttgcatcattggcggcggcgagatctaccgt
cagtcgatcggcatggccgatgtgctgcacgtgaccgaagtgcaggcggaggtggatggc
gatacgcgcttcccttctatcgacccggcgactttcgagaaggtgatggaggaagatctt
ccgcgcagcgagaaagacagtcacgcaatgcatttcgtgacctggcgccgccgcacgccg
ccgccggaaggtgcgggagcctga

DBGET integrated database retrieval system