KEGG   Sinorhizobium meliloti AK83: Sinme_2206Help
Entry
Sinme_2206        CDS       T01521                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sinme_2206
   01230 Biosynthesis of amino acids
    Sinme_2206
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinme_2206
   00051 Fructose and mannose metabolism
    Sinme_2206
   00562 Inositol phosphate metabolism
    Sinme_2206
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Sinme_2206
Enzymes [BR:smk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sinme_2206
Exosome [BR:smk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sinme_2206
  Exosomal proteins of bladder cancer cells
   Sinme_2206
  Exosomal proteins of melanoma cells
   Sinme_2206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2217381..2218148)
Genome map
AA seq 255 aa AA seqDB search
MSKSGLWVGTSWKMNKTLAEAMVFADGLAAADDARDQRIQRFVIPPFTAARQVKERLKAT
SVKVGAQNMHWDDAGAWTGEISPVMLSDCDLDIVELGHSERREHFGETDRTVGLKTAAAV
KHGLVPLICIGETLAQREAGEADTVLKRQVEGAFAFLEGAARKAPVLLAYEPVWAIGVNG
IPATADYADARHRLIGEVAERALGVKVPVLYGGSVNPQNCEELILQPHIDGLFIGRSAWD
VGGYLDILQRVARAI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtctggtctctgggtcggcacgagctggaagatgaacaagacgctggccgag
gcaatggtcttcgccgacggtcttgctgccgccgacgatgcgcgcgatcagcggatacag
cgcttcgtcattcctccgttcaccgccgcgcggcaggtgaaggaaaggcttaaggcgacg
agcgtcaaggtcggtgcgcagaacatgcactgggacgatgccggcgcctggaccggcgaa
atttccccggtcatgctgagcgattgcgatctcgacatcgtcgagctcggccacagcgag
cggcgggagcatttcggcgagaccgaccgcaccgtgggcttgaagacggcagccgccgtc
aagcatgggctcgtgccgttgatctgcatcggcgaaactctcgcgcaacgcgaagcgggc
gaggcggatactgtcctgaagcgccaggtggaaggcgcctttgcctttctcgaaggcgcg
gcgcggaaggcgcccgttcttctggcttacgagcccgtctgggcgatcggcgtcaacggc
ataccggcgaccgccgactatgcggacgcccgccatcgcctcattggcgaagtcgccgag
cgtgcactcggcgtgaaggttccggtgctctatggcggcagcgtcaatcctcagaactgc
gaggaattgatcctccaaccccatatcgacgggctcttcatcggccgctccgcctgggac
gtcggcggctatctcgacattttgcaacgcgtagcccgggcgatctga

DBGET integrated database retrieval system