KEGG   Sinorhizobium meliloti AK83: Sinme_2805Help
Entry
Sinme_2805        CDS       T01521                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:smk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2818907..2819524)
Genome map
AA seq 205 aa AA seqDB search
MIGKLKGTIDEIGEDHVVLDVHGVGYVAHCSARTLGKLGSAGEAAVLFIETYVREDQLKL
FGFLSALEREWFRLLQSVQGVGSKVALAVLSTLTPGELANAIALQDKTSISRAPGVGPKV
AVRIVTELKNKAPAFSGEMAPSIGLKQELGEGVAAAPVADAVSALTNLGYSRDQAANAVA
AALKNGGEGGDSAKLIRLGLKELSR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattggcaagctcaagggcacgatagacgagatcggcgaggatcacgtggttctcgac
gtgcatggggtcgggtatgtcgcccattgctccgcgcgcacgctcggaaagctcggaagc
gctggagaggcggccgtactcttcatcgagacctatgtgcgcgaggatcagctgaagctg
ttcgggttcctgagcgcgttggagcgcgaatggttccgcctgcttcagagcgttcagggt
gtgggatccaaggtggcgctggcggtgctctccacgctgacccccggggaactcgccaat
gccatcgccttgcaggacaagacgtcgatctcgcgcgcgccgggcgtgggtccgaaagtt
gccgtgcgcatcgtcaccgaactcaagaacaaggctccggccttctccggcgagatggca
ccatcgatcggcctcaagcaggagctcggcgaaggcgttgccgcagcgccggttgcggac
gcggtctcggcgctcaccaatctcggctattcgcgagaccaggcggccaacgccgttgcg
gctgcgctgaaaaacggcggggagggcggcgacagcgccaagctgatccgcctcggcttg
aaggaactgtcgcggtga

DBGET integrated database retrieval system