KEGG   Sinorhizobium meliloti AK83: Sinme_2862Help
Entry
Sinme_2862        CDS       T01521                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00040  Pentose and glucuronate interconversions
smk00052  Galactose metabolism
smk00500  Starch and sucrose metabolism
smk00520  Amino sugar and nucleotide sugar metabolism
smk01100  Metabolic pathways
smk01130  Biosynthesis of antibiotics
Module
smk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sinme_2862
   00052 Galactose metabolism
    Sinme_2862
   00500 Starch and sucrose metabolism
    Sinme_2862
   00520 Amino sugar and nucleotide sugar metabolism
    Sinme_2862
Enzymes [BR:smk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sinme_2862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEG54569
JGI: Sinme_2862
Position
1:complement(2878507..2879394)
Genome map
AA seq 295 aa AA seqDB search
MTDKRKVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDKPVIQYVVDEALEAGIEHLIFVT
GRSKAVIEDYFDIQVELDQTLRERNKKAEIELLEAMLPKAGTTSFTRQQAPLGLGHAVWC
ARDLVGNEPFALLLPDMIMKGEKGCLKGMVELYEESGGNVVAVEECAPDQAHKYGIVGVG
ETVGDGFRITRMVEKPAKGTAPSNFFINGRYILQPEIFPILETQERGAGNEIQLTDGMVK
LAEAQPFAAYHFRGDTYDCGAKDGFILANVAFALERGDIRPIVEGPLKTLLQGLK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagcgcaaagtccgcaaagccgttttccccgttgcaggtctcgggacccgt
ttccttccggcgaccaaggcggttccgaaggagatgctgacggtggtggacaagccggtc
atccaatatgttgtcgatgaggcgctcgaagccggcatcgagcatctgattttcgtgacc
ggccgcagcaaggcggtcatcgaggactatttcgacatccaggtcgaattggaccagacg
ctgcgcgagcgcaacaaaaaggcggagatcgagctcctcgaagccatgctgccgaaggcc
ggcaccacgagcttcacccgccagcaggcacccctgggcctcggccatgccgtctggtgc
gcccgcgatctcgtcggcaatgagcccttcgctctgctcctgcccgatatgatcatgaag
ggcgagaagggttgcctcaagggcatggtcgagctctacgaagagtccggcggcaacgtc
gtcgcggtggaggaatgcgcgcccgaccaggcgcataaatacgggatcgtcggagtgggc
gagacggtcggcgacggtttcaggatcaccaggatggtcgagaagccggccaaggggacg
gctccgtcgaacttcttcatcaatggccgctacatcctgcagccggagattttcccgatc
ctggaaacgcaggaacgcggcgccggcaacgagatccagctgaccgacggcatggtgaag
cttgccgaggcccagcccttcgccgcctatcacttccgcggcgatacgtatgactgcggc
gccaaggacggcttcatcctggcgaacgtcgccttcgctctcgagcgcggcgatatccgc
cccatcgtggaaggaccgttgaagacgctcctgcagggtcttaagtaa

DBGET integrated database retrieval system