KEGG   Sinorhizobium meliloti AK83: Sinme_2877Help
Entry
Sinme_2877        CDS       T01521                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sinme_2877
Enzymes [BR:smk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sinme_2877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2900566..2901549
Genome map
AA seq 327 aa AA seqDB search
MTTLLHSMPENPMPGDPVVGFFDGARNRKIRYAVFRSKAPVIRGTIVLLQGRNESIEKYF
ETIGDLMAAGFWVATFDWRGQGGSERLSPQWTHGHVEDFTDYERDLTIFLDEIVLPDTRL
PFSIVAHSMGALVALSLAPMLASRIDRMVLLAPFVGLGGQAIGERGIAAIATVMRWIGLG
RLALSSDKGNGTPFRGNVLTADDRRYARNLALIDARPQLRVGPPTARWLSEAFRTIRRVL
KHEHLTRITIPAVILAPTADKLVPYLPVERLASNFRAGHLIPIDGARHELLQEADRYRAQ
AMAAILAFLPGADAEDPASLPRQLEEA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctccttcactcgatgccggaaaatccgatgccgggcgatccggtggttggc
tttttcgacggagcccgcaaccgcaagatccgctacgcggtgttcaggtcgaaggccccg
gtcattcgcggcaccatcgtcctgctgcagggtcgcaacgagtcgatcgagaaatacttc
gaaacgatcggcgatctcatggcggccggtttctgggtcgcgaccttcgactggcgcgga
cagggcggctccgagcggctgtcgccgcaatggacccacggccatgtggaggatttcacc
gattacgagcgcgacctgacgatttttctcgatgagatcgtccttcccgacacccgcctg
cccttctcgatcgtcgcccattcgatgggggcgctcgtcgccctgtcgctcgctcccatg
ctcgcaagccgcatcgaccggatggtgctgcttgcccccttcgtcggtctggggggccag
gcgatcggcgaacggggtatcgcagcgatcgcgacggtcatgcgctggatcggcctcggg
aggctggcgctgagttccgacaaaggcaacggtaccccttttaggggcaatgttctgacc
gcggacgaccggcgctacgcccgcaacctggcgctcatcgatgcgcgtccgcaactgcgg
gtcggaccgcccacggcccgctggctgagcgaggccttccgaacgatccggcgcgtcctc
aagcacgaacatctgacgaggatcaccataccggccgtcatactcgccccgacggccgat
aagctcgtgccgtatctcccggtcgagcggttggccagcaatttccgtgcggggcatctg
atcccgatcgacggcgcgcggcacgaactcctgcaggaggccgaccgctatcgcgcccag
gcgatggccgcgatcctggcctttctgccgggcgccgatgcggaggaccccgcgtccctg
ccgcgacagttggaagaggcttaa

DBGET integrated database retrieval system