KEGG   Sinorhizobium meliloti AK83: Sinme_3042Help
Entry
Sinme_3042        CDS       T01521                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00900  Terpenoid backbone biosynthesis
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sinme_3042
Enzymes [BR:smk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Sinme_3042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: AEG54749
JGI: Sinme_3042
Position
1:3093086..3094261
Genome map
AA seq 391 aa AA seqDB search
MASGDDLKRRLTILGSTGSIGTSTLDVIERLGGRDRFEIAALTGNGNIPLLAEQARRIGA
ELAVTADEDRYGELKDALSGSGIEVAAGRSGLTEAAERDAGWVMAAIVGNAGLGPTLAAA
RRGADIALANKECLVSAGSLFIDAVAEGGGRLLPVDSEHNAIFQVLENDQRHAVERIVLT
ASGGPFRTKTLDEMRHVTADVARAHPNWSMGLKISIDSASMFNKALEMIEARHLFRLRPE
QIEVIVHPQSVVHSMVGYTDGSVLAQLGCPDMRTAIGYALSYPKRCDLPVERLDFARLAR
LDFEAPDEVRFPAIKLARRAMEEGGVQGAVLNGAKETALDAFIKGRIGFLAMAEIVEKVM
DGLAGLPAATSMDDVFAADERARRAAAEMIR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcatccggcgatgacttgaagcgccgtctgacgatattgggctccaccggatcgatc
gggaccagcacgctcgacgtgatcgagcgcctcggcggacgcgatcgtttcgagatcgcc
gccctgaccggcaacggcaatataccgctgctggccgagcaggcgcgccgcatcggcgcc
gagctcgcggtaaccgccgacgaggatcgctatggcgagctcaaggatgcgctgagcggc
agcggcatcgaggtcgccgccggacgaagcggcctcaccgaagcggccgagcgggatgcc
ggctgggtcatggcggcgatcgtcggcaatgccggcctcggccccaccctggcggctgcc
cgccgcggcgcagacatcgcgcttgccaacaaggaatgtctcgtttccgccggcagcctt
ttcatcgatgccgtggccgagggcggcggccggttgctgcccgtcgacagcgaacacaat
gcgatcttccaggtgctggaaaacgatcagcgccacgccgtggaacgcattgtcctcacc
gcttccggcggccctttccgcaccaagacgctcgacgaaatgcggcacgtgaccgcggat
gtggcccgcgcccatccgaactggtcgatgggcctcaagatatcgatcgacagcgcctcg
atgttcaacaaggcgctcgagatgatcgaggcgcgccacctcttccgtctcaggccggag
cagatcgaggtgatcgtccacccgcaatcggtggttcactccatggtcggctatacggac
ggctccgtactcgcacagctcggctgccccgacatgcgcaccgcaatcggctatgccctg
tcctacccgaaacgctgcgacctgccggtcgagcgcctcgacttcgccaggctcgcccgg
cttgatttcgaggcgccggacgaggtccgcttcccggcgatcaaactcgcgcgccgggca
atggaggaaggcggcgtgcagggcgcggtgctgaacggcgccaaggagaccgccctcgat
gccttcatcaagggccgcatcggcttcctcgccatggcggaaatcgtcgaaaaggtgatg
gacgggcttgccggcctgccggccgccacgagcatggacgacgtctttgcggccgatgaa
agagcccggcgggcggctgccgagatgatccggtag

DBGET integrated database retrieval system