KEGG   Sinorhizobium meliloti AK83: Sinme_3056Help
Entry
Sinme_3056        CDS       T01521                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00220  Arginine biosynthesis
smk00330  Arginine and proline metabolism
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01130  Biosynthesis of antibiotics
smk01230  Biosynthesis of amino acids
Module
smk_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Sinme_3056
   00330 Arginine and proline metabolism
    Sinme_3056
Enzymes [BR:smk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Sinme_3056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEG54763
JGI: Sinme_3056
Position
1:3114201..3115124
Genome map
AA seq 307 aa AA seqDB search
MKTITLIGAPIEEGSGRRGAAMGPTALRIAGIDTVLAELGHTVNDEGDLRPLPARDLANH
PGANNLQSVAAFARALDEAVHDTARKGHFPIILGGDHALSMGSVSGMARHAQDVGRPLFV
LWLDAHADFNSPATSPSGNMHGMPVAFFCGEAEFAPILPKDRPLVDPKKVYQVGIRSVDA
REREEIAEHGVNVFDMRAIDEMGMAHIIRQIVDEVRAANGLLHVSLDVDFMDPELAPGVG
TTVPGGATFREAHLIMEVLCDSGLVSSLDVVELNPFLDDRGKSARILVELTASLFGRRIL
DRPTRAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatcacattgatcggcgcacccatcgaggaaggctcgggccgccgcggcgca
gccatggggccgacggcgctcaggatcgccggcatagacacggtcctcgccgaactcggc
catacggtcaatgacgagggggatctgaggccgctgcccgcgcgcgatctcgccaaccat
cccggcgccaacaatctgcagtccgttgcagctttcgcgcgcgcgctcgacgaagccgtg
cacgataccgcgcgcaagggacatttccccatcattctcgggggcgaccacgcgctgtcg
atgggcagcgtctccggcatggcgcgtcacgcccaggacgtcggccggcccctcttcgtc
ctctggctcgacgcgcatgccgacttcaactcgcctgcgacctcgccctccggaaacatg
cacggcatgccggtcgccttcttctgcggcgaagcggagttcgccccgatccttccgaag
gaccggccgctggtcgacccgaagaaggtctatcaggtcggaatccgctcggtcgacgcg
cgtgagcgcgaggaaatcgccgagcacggcgtcaatgtcttcgatatgcgggccatcgac
gagatgggcatggcccacatcatccgtcagatcgtcgacgaggttcgcgccgccaacggc
ctgctgcatgtgagcctcgacgtcgatttcatggatccggaacttgcccccggcgtgggc
acgacggtcccgggcggcgcgaccttccgcgaggcgcacctcatcatggaagtactgtgc
gacagcggcctcgtctcttccctcgatgtcgtcgagctcaacccgttcctcgacgaccgg
ggcaagagcgcgcgcattctggtcgaactgacggcaagcctcttcggccgccgtatcctt
gatcgtccgactcgcgcggcctga

DBGET integrated database retrieval system