KEGG   Sinorhizobium meliloti AK83: Sinme_3056Help
Entry
Sinme_3056        CDS       T01521                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sinme_3056
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sinme_3056
Enzymes [BR:smk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Sinme_3056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3114201..3115124
Genome map
AA seq 307 aa AA seqDB search
MKTITLIGAPIEEGSGRRGAAMGPTALRIAGIDTVLAELGHTVNDEGDLRPLPARDLANH
PGANNLQSVAAFARALDEAVHDTARKGHFPIILGGDHALSMGSVSGMARHAQDVGRPLFV
LWLDAHADFNSPATSPSGNMHGMPVAFFCGEAEFAPILPKDRPLVDPKKVYQVGIRSVDA
REREEIAEHGVNVFDMRAIDEMGMAHIIRQIVDEVRAANGLLHVSLDVDFMDPELAPGVG
TTVPGGATFREAHLIMEVLCDSGLVSSLDVVELNPFLDDRGKSARILVELTASLFGRRIL
DRPTRAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatcacattgatcggcgcacccatcgaggaaggctcgggccgccgcggcgca
gccatggggccgacggcgctcaggatcgccggcatagacacggtcctcgccgaactcggc
catacggtcaatgacgagggggatctgaggccgctgcccgcgcgcgatctcgccaaccat
cccggcgccaacaatctgcagtccgttgcagctttcgcgcgcgcgctcgacgaagccgtg
cacgataccgcgcgcaagggacatttccccatcattctcgggggcgaccacgcgctgtcg
atgggcagcgtctccggcatggcgcgtcacgcccaggacgtcggccggcccctcttcgtc
ctctggctcgacgcgcatgccgacttcaactcgcctgcgacctcgccctccggaaacatg
cacggcatgccggtcgccttcttctgcggcgaagcggagttcgccccgatccttccgaag
gaccggccgctggtcgacccgaagaaggtctatcaggtcggaatccgctcggtcgacgcg
cgtgagcgcgaggaaatcgccgagcacggcgtcaatgtcttcgatatgcgggccatcgac
gagatgggcatggcccacatcatccgtcagatcgtcgacgaggttcgcgccgccaacggc
ctgctgcatgtgagcctcgacgtcgatttcatggatccggaacttgcccccggcgtgggc
acgacggtcccgggcggcgcgaccttccgcgaggcgcacctcatcatggaagtactgtgc
gacagcggcctcgtctcttccctcgatgtcgtcgagctcaacccgttcctcgacgaccgg
ggcaagagcgcgcgcattctggtcgaactgacggcaagcctcttcggccgccgtatcctt
gatcgtccgactcgcgcggcctga

DBGET integrated database retrieval system