KEGG   Sinorhizobium meliloti AK83: Sinme_3133Help
Entry
Sinme_3133        CDS       T01521                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:smk00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3196544..3197251
Genome map
AA seq 235 aa AA seqDB search
MRVLVTRPRPAAERTAARLSAMGHEAVILPLMQAQHLAGAARAALSEPHQAIAVSSGEAV
RVLGALGPALEPHLATPLFAVGEATARAAGDLGFTDVRIGPGTGEGLAETVAALLPPGET
LVYLAGSPRTDGFERALHQRRIEHRTAECYRMAPVHYPAETLPGLLRAGPFDAVMLYSRE
SARRLDAALRESGLEPADLASRFLCLSWPIRETLPDGLPCGVAAVPDEENLLRLL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgctcgtgacccggccacgcccggccgccgaaaggacggcggcaaggctcagc
gccatgggtcacgaagcggtcatcctgccgcttatgcaggcgcagcatctcgccggcgcg
gcccgggcagcattgagtgagccccaccaggcgatcgccgtcagcagtggggaggcggtc
cgcgtcctcggcgcgctcggaccggcgcttgagccacaccttgcaactccgctctttgca
gtcggcgaagcgacggcgcgcgctgcgggcgatctcggatttaccgatgtccgcatcgga
ccgggaaccggcgaaggactcgccgagacggtggctgcccttctcccccccggcgaaacg
ctggtctatctcgccggttcaccgcgaaccgacggtttcgaacgggcattgcaccaacgg
cggatcgagcacaggaccgccgaatgctaccggatggcgccggtccactatcctgcggag
acgctgcccggactcctccgcgcgggccccttcgatgcggtcatgctctattcccgcgag
agcgcgcggcgcctggacgcagcattgcgggagagcgggcttgaacccgcggacctcgcc
tcgcgctttctctgcctgagctggccgataagagagaccctgccggacggtctaccctgc
ggggtcgcggcggtgccagacgaggaaaatctcttgcggcttctttga

DBGET integrated database retrieval system