KEGG   Sinorhizobium meliloti AK83: Sinme_3177Help
Entry
Sinme_3177        CDS       T01521                                 

Definition
aldose-1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sinme_3177
   00052 Galactose metabolism
    Sinme_3177
Enzymes [BR:smk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Sinme_3177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3237727..3238743
Genome map
AA seq 338 aa AA seqDB search
MGTDTEIFGHLPSGEPVQRVTLKGGGLTASVITWGSVIQDLRLEGHAAPLVLGFENFESY
PAHSSYFGATPGRNANRIGAGRFALEGKAYQLELNESGATHLHGGSDNIAKRNWSIRRRA
EDSVTLEITDPDGRAGYPGNCTITCTYTLKPGGTLNVVYETETDAPTLANVCQHSYFNLD
GGSDAFGHDIMIAADHYLPTDERQIPTGEIRPVAGTAFDLREMTSLGRQLDGGGIAYDHN
FCLSPERVQKRSVALVRSINSGVSLEVLTTEPGVQLYTGEKLDVPVPGLEGRRYGPFAGF
CLETQIWPDAVNHEGFPKAVLRPGETLRQETDYVFTKN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgggaacagacacggaaatcttcggccacctgccctccggcgagcccgtacagcgcgtg
acgcttaagggcggcgggctgacggcgtcggtgatcacctggggctcggtcatacaggac
ctgcggctcgaaggacatgcagccccgctcgtgctcggcttcgagaatttcgaaagctat
ccggcccattcctcctatttcggcgccacccccggccgcaacgccaaccgcatcggcgcc
ggccgcttcgcgctcgaaggcaaggcctatcagctcgagctcaacgagagcggcgccacg
catctccacggcggcagcgacaatatcgccaagcgcaactggtcgatccgcaggcgggct
gaagacagcgtaacgctcgagatcaccgatccggacggccgtgccggctacccgggcaat
tgcacgatcacctgcacctatacgctgaaaccgggcggcacgctcaacgtcgtctacgaa
actgagaccgacgcgccgaccctcgccaatgtctgccagcacagctatttcaacctcgac
ggcggctcggacgcattcggccacgacatcatgatcgcggcagaccactacctgcccacc
gacgagcggcagattccgacgggcgagatccgccccgttgccggcaccgccttcgatctg
cgcgaaatgacctcgcttggaaggcagctggacggcggcggaatcgcctatgaccacaat
ttctgcctctcgccggagcgcgtgcagaagcgctccgtggcgctcgtacgcagcatcaat
tccggtgtgtcgctggaagtgctgacgacggagcccggcgtgcagctctataccggagaa
aagctcgacgtaccggttcccggcctcgaaggccgccgttacggccccttcgccggcttc
tgcctcgaaacgcagatctggcccgatgcggtgaaccacgaaggtttcccgaaggcggtg
ctgagaccgggcgaaacgctccggcaggaaacggattacgttttcacgaagaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system