KEGG   Sinorhizobium meliloti AK83: Sinme_3216Help
Entry
Sinme_3216        CDS       T01521                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sinme_3216
Enzymes [BR:smk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sinme_3216
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Sinme_3216
Lipid biosynthesis proteins [BR:smk01004]
 Fatty acid synthase
  Component type
   Sinme_3216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3276672..3277313)
Genome map
AA seq 213 aa AA seqDB search
MALKDFLPILFGLTMTIVLSAAARAEPVSLVGFGDSLMAGYQLPPEDAFPARLEKALKEK
GIDVTIANAGVSGDTTSSGLARIDWSIPEGTDGVILELGANDALRGIPPEETRKNLEAMV
ARLKERGVAVLLAGMMAPPNMGPDYAARFNPIYPDLAKEHNLVFYPFFLDGVVTEVGLKL
DDGMHPNGGGVGVMVDRFLPTAELFVRSLAKGE
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcattaaaagactttctgcccattttattcggcctgacaatgacaatcgtgttatcg
gcggcggctcgcgccgagcccgtcagcctcgtcggcttcggcgacagcctgatggccggc
taccaactccccccggaagatgccttccccgcccgcctcgaaaaggccctgaaggaaaag
gggatcgacgtcacgatcgccaatgccggcgtttccggcgacacgacctccagcggtctc
gcccgcatcgactggtcgatccccgagggcaccgacggcgtcatcctcgaactcggcgcc
aacgacgcgttgcgcggcatccctccggaggagacgcgcaagaatctggaggcgatggtc
gcacggctcaaggagcgcggcgtcgccgtcctgctcgcgggaatgatggcgccgccgaac
atggggccggattatgcggcgcgcttcaatccgatctatcccgacctcgcaaaggaacac
aatctcgttttctaccctttcttcctcgacggcgtcgtcaccgaggtcggcctgaagctc
gacgacgggatgcatccgaacggcgggggtgtcggcgtcatggtagaccgcttcctgccg
acggcggagcttttcgtccgctcacttgcgaaaggagaatga

DBGET integrated database retrieval system