KEGG   Sinorhizobium meliloti AK83: Sinme_3359Help
Entry
Sinme_3359        CDS       T01521                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sinme_3359
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sinme_3359
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinme_3359
Enzymes [BR:smk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sinme_3359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
1:3452093..3453313
Genome map
AA seq 406 aa AA seqDB search
MNQPPKPNSFRSGPDEEGRFGIFGGRFVAETLMPLILDLQDEWARAKNDPAFKAELENLG
THYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVKPVTAGNGTLKD
AMNEALRDWVTNVDSTYYLIGTAAGPHPYPEMVRDFQAVIGEEAKQQILEAEGRLPDLVV
AAVGGGSNAIGIFHSFLDDEGVRIVGVEAGGKGLDGDEHCASLTAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHAWLNDIGRVEYVPIMDHEALEAFQTLTRLEGIIPA
LEPSHALAEVIKRAPKMGKDEIILMNLSGRGDKDIFTVGKILGMGQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcaaccgcctaaaccgaactccttcaggtccggacccgatgaagagggccgtttc
ggcatattcggcgggcgcttcgtcgccgagacgctgatgccgctgatcctcgatctccag
gatgaatgggcgagggcgaagaacgatccggctttcaaggcggaactcgaaaatctcggc
acccactatatcggccggccgagcccgctctatttcgccgagcgcctgacggccgaactc
ggtggcgccaagatctatttcaagcgcgaggagctcaatcacacgggctcccacaagatc
aacaattgcatcggccagatcctgctcgccaagcgcatgggcaagacccgcatcatcgca
gaaaccggcgccggccagcacggagtggcatcggcgacggtcgcggcgcgcttcggcctg
ccctgcgtggtctacatgggtgcgaccgacgtggagcggcaggcgccgaacgtcttccgc
atgaagcttctcggcgccgaggtgaagccggtgaccgccggcaacggcaccctcaaggac
gccatgaacgaggcgttgcgcgactgggtgaccaatgtcgacagcacctattacctgata
ggcacggccgccggcccgcatccctatccggagatggtgcgcgacttccaggcagtcatc
ggtgaggaagccaagcagcagatcctcgaagccgaaggccggcttcccgatctcgtcgtc
gccgccgtcggcggcggttccaatgcgatcggcatcttccattcgttcctcgacgacgag
ggcgtcaggatcgtcggcgtcgaagcgggtggcaaggggctcgacggcgacgagcattgc
gcttcgctgaccgccggctcgcccggcgtgctccacggcaaccgcacctatcttcttcag
gacggtgacggccagatcaaggaaggccattcgatctcggccgggctcgattatcctggc
atcggaccggaacatgcctggctgaacgacatcggccgcgtcgaatatgtgccgatcatg
gatcatgaggcactcgaggcctttcagacgctgacgcggctcgaaggcatcatcccggcg
ctcgaaccgtcccatgcgcttgccgaagtcatcaagcgcgcgccgaaaatgggcaaggac
gagatcatcctgatgaatctctccggtcgcggcgacaaggacattttcaccgtcggcaaa
attctcggtatggggcagtaa

DBGET integrated database retrieval system