KEGG   Sinorhizobium meliloti AK83: Sinme_3360Help
Entry
Sinme_3360        CDS       T01521                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sinme_3360
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sinme_3360
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sinme_3360
Enzymes [BR:smk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sinme_3360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
1:3453319..3454158
Genome map
AA seq 279 aa AA seqDB search
MTARMEQRFADVAAEGRPVLVTYFMGGDPDFDTSLAIMKALRQAGADIIELGVPFSDPMA
DGPAIQLAGQRALKAGQSLAKTLELARLFRAEDQRTPIVLMGYYNPIYIYGVERFLADAL
EAGVDGLIVVDLPPEMDDELCIPALEKGISFIRLATPTTDDRRLPKVLENTSGFVYYVSM
TGITGSALPDPSLIAGAVARIKAHTPLPVCVGFGVKTADHARAIGASADGVVVGTAIVNQ
IASSLTEEGRATEATVPGVEALVRGLAAGVRAARLAAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcatggagcaacggttcgccgacgtggcggccgaggggcgcccggtcctc
gtgacctatttcatgggcggcgacccggatttcgacacgtcgctggcgatcatgaaggcg
ctgcggcaggcgggtgccgacatcatcgaactcggcgtgcccttttccgacccgatggcc
gatggaccggcgatccagctcgccggccagcgcgcgctgaaggcggggcagtctctcgcc
aagacgctggagctcgcccggctcttccgggcggaggaccagcgcacccccatcgtgctg
atgggctattacaacccgatctatatctatggcgtcgagcggttcctggcggacgcactc
gaggccggcgtcgacggcctgatcgtcgtcgatctgcccccggaaatggacgacgaactc
tgcattccggcacttgagaagggcatcagcttcatccgcctggcaacgcccacgacggac
gatcgccgcctgcccaaggttctcgaaaacacgtcgggtttcgtgtattacgtctcgatg
accgggatcaccggctcggcgctgcccgatccgtcgctgatcgccggagcggtcgcgcgc
atcaaggcgcatacgcccttgcctgtctgcgtcggcttcggggtgaagaccgccgaccat
gcgcgcgccatcggcgcatccgcagacggcgtcgtcgtcggcacggcgatcgtcaatcag
atcgcgtcgagcttgaccgaagaaggccgggcaacggaagcgacggtcccgggtgtcgaa
gcgctcgtcagggggcttgcggccggcgtacgggcggcacggcttgctgcagccgaataa

DBGET integrated database retrieval system