KEGG   Sinorhizobium meliloti AK83: Sinme_3461Help
Entry
Sinme_3461        CDS       T01521                                 

Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00240  Pyrimidine metabolism
smk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sinme_3461
Enzymes [BR:smk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Sinme_3461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AEG55166
JGI: Sinme_3461
Position
1:3576730..3578052
Genome map
AA seq 440 aa AA seqDB search
MAMLPQEIIRKKRDGDRLDPAEIAGFIAGVTDGSVSEGQAAAFAMAVWFSGMNRDECVAL
TLAMRDSGETLDWSDLARPIVDKHSTGGVGDNVSLMLAPIVAACGAAVPMISGRGLGHTG
GTLDKLESIPGYDIQPSPELFRRVADEVGCAIIGQTADLAPADKRLYAIRDVTATVDSVP
LITASILSKKLAAGLRSLVLDVKLGNGSFMTDPAETEVLARSLVEVANGAGVRTSALITD
MNEPLADAAGNALEIENCLAYLRGEKAGTRLDQVVMALAAEMLVAAGIAAHEAEAEAMAR
RVLGSGEAMERFGLMVHRLGGPADFVDRPGAYLAKAPAILAVPAGRHGYLTSCKTRELGM
AVIELGGGRIRPDDRIDHRVGLTGLRPLGTKVEKGEPIAFVHAADQSQAEAIAKRVVTLY
AIADEEPARRPVIVSKLRAG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggccatgcttccgcaggaaatcatacgaaagaaaagggacggcgatcggctcgatccg
gcggagatcgccggtttcatcgcgggcgtgaccgatggctcggtctcggaagggcaggcg
gctgccttcgccatggcggtctggttctccggcatgaatcgcgacgaatgcgtggcgctg
acgctggcgatgcgcgattccggggaaacgctcgactggagcgatctcgcacgccccatt
gtcgacaagcactcgacgggcggagtcggcgacaatgtctcgctcatgttggcgccgatc
gtcgccgcctgcggtgcggccgtgccgatgatttcgggccgggggctcggccacaccggc
gggacgctcgacaagctcgaatcgatccccggctatgacatccagccttcgccggaactg
ttccgccgcgtggccgacgaggtcggctgcgcgatcatcggccagacggccgatctggcg
ccggccgacaagcgcctctatgcgatccgcgacgtgacggcgacggtcgattcggtgccg
ctgatcaccgcatcgatcctgtcgaaaaagctcgccgcagggctacggtcgctggtgctc
gacgtcaagctcggcaacggctccttcatgaccgatcctgccgaaaccgaagtcctggcg
cgttcgcttgtcgaggtcgccaatggtgcgggcgtgcgcacctctgcgctgatcaccgac
atgaacgagccgctggcggacgcggccggcaacgcgctcgaaatcgagaactgcctggcc
tatctgcgcggcgagaaagcgggaacccgcctcgatcaggtcgtgatggccttggctgcg
gagatgctcgttgcagcgggtattgcggctcacgaagccgaagccgaagccatggcgcgg
cgcgttttggggagcggggaggcgatggagcgcttcggcctcatggtgcatcggctcggc
ggccctgccgattttgtcgatcgcccgggcgcctatcttgccaaggcacccgcgatcctt
gccgtgccggcgggccggcatggttatctcacgtcctgcaagacgcgcgaactgggaatg
gcagtcatcgagctcggcggcgggcgcatccgcccggatgaccggatcgatcaccgcgtc
ggtcttaccggcctgaggccgctcgggacgaaagtcgaaaagggcgagccgatcgccttc
gtccatgctgccgaccaaagccaggccgaggcgatcgcaaaacgggtcgtaacgctctat
gcgatcgcagacgaggagccggcgcgacggccggtgatcgtttcgaagctcagagcggga
tga

DBGET integrated database retrieval system