KEGG   Sinorhizobium meliloti AK83: Sinme_3549Help
Entry
Sinme_3549        CDS       T01521                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Sinme_3549
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sinme_3549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3674336..3675115)
Genome map
AA seq 259 aa AA seqDB search
MNPYVNMGVGALLGTVFVLMSVSIASEGIFHSEAPEKEGFAIVAEETAGEADAAGGEEAK
SEPIGPMLASADASAGEGVFKKCASCHTVEKGGPNKVGPNLWSVVNRPVASHEGFSYSAG
MQTFAEGGKVVWDYDHLSYFLEAPKKHVPGTAMGFAGIKKVDERANLIAWLREQADSPAP
LPDAGAAGSTEAAPAAGQEGQAPAAAEGAAAPAPAEGGAAPAATEASPAPAEGGATPAPA
EGEAAPAGQIGAPAPAPAN
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatatgtgaacatgggtgtgggtgccttgttgggtacggtcttcgttctgatg
tccgtatccattgcgtcggaaggcattttccattccgaagctcccgagaaggaaggtttc
gccattgtcgccgaggaaacggcaggcgaagcggatgctgccggcggcgaggaagcgaag
tccgagccgatcgggccgatgctcgccagcgccgatgcctccgccggcgagggcgtgttc
aagaaatgcgcaagctgtcacaccgtggagaagggcggaccgaacaaggtcggcccgaat
ctctggagcgtcgtcaaccgcccggtcgcctcgcatgagggcttcagctattccgcgggc
atgcagaccttcgcagaaggcggcaaggtcgtgtgggactacgatcatctgagctacttc
ctcgaagcgccgaagaagcacgtgcccggcacggcgatgggcttcgccggcatcaagaaa
gtcgacgagcgcgccaacctgatcgcctggctgcgtgagcaggcggacagcccggccccg
ctgccggacgccggcgcggcaggctcgaccgaggcggcaccggctgctggtcaggaggga
caggcccccgccgctgccgaaggtgccgcagctcccgctccagctgaaggcggtgcggcc
cctgcagccactgaagccagcccggccccggctgaaggcggagcaactcccgccccggct
gaaggcgaggctgctccggcaggtcagatcggcgctccagcgccggctccggcaaactga

DBGET integrated database retrieval system