KEGG   Sinorhizobium meliloti AK83: Sinme_3549Help
Entry
Sinme_3549        CDS       T01521                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk01100  Metabolic pathways
smk01120  Microbial metabolism in diverse environments
smk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Sinme_3549
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sinme_3549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AEG55254
JGI: Sinme_3549
Position
1:complement(3674336..3675115)
Genome map
AA seq 259 aa AA seqDB search
MNPYVNMGVGALLGTVFVLMSVSIASEGIFHSEAPEKEGFAIVAEETAGEADAAGGEEAK
SEPIGPMLASADASAGEGVFKKCASCHTVEKGGPNKVGPNLWSVVNRPVASHEGFSYSAG
MQTFAEGGKVVWDYDHLSYFLEAPKKHVPGTAMGFAGIKKVDERANLIAWLREQADSPAP
LPDAGAAGSTEAAPAAGQEGQAPAAAEGAAAPAPAEGGAAPAATEASPAPAEGGATPAPA
EGEAAPAGQIGAPAPAPAN
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatatgtgaacatgggtgtgggtgccttgttgggtacggtcttcgttctgatg
tccgtatccattgcgtcggaaggcattttccattccgaagctcccgagaaggaaggtttc
gccattgtcgccgaggaaacggcaggcgaagcggatgctgccggcggcgaggaagcgaag
tccgagccgatcgggccgatgctcgccagcgccgatgcctccgccggcgagggcgtgttc
aagaaatgcgcaagctgtcacaccgtggagaagggcggaccgaacaaggtcggcccgaat
ctctggagcgtcgtcaaccgcccggtcgcctcgcatgagggcttcagctattccgcgggc
atgcagaccttcgcagaaggcggcaaggtcgtgtgggactacgatcatctgagctacttc
ctcgaagcgccgaagaagcacgtgcccggcacggcgatgggcttcgccggcatcaagaaa
gtcgacgagcgcgccaacctgatcgcctggctgcgtgagcaggcggacagcccggccccg
ctgccggacgccggcgcggcaggctcgaccgaggcggcaccggctgctggtcaggaggga
caggcccccgccgctgccgaaggtgccgcagctcccgctccagctgaaggcggtgcggcc
cctgcagccactgaagccagcccggccccggctgaaggcggagcaactcccgccccggct
gaaggcgaggctgctccggcaggtcagatcggcgctccagcgccggctccggcaaactga

DBGET integrated database retrieval system