KEGG   Sinorhizobium meliloti AK83: Sinme_3560Help
Entry
Sinme_3560        CDS       T01521                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:smk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sinme_3560
DNA repair and recombination proteins [BR:smk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sinme_3560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3683239..3683844
Genome map
AA seq 201 aa AA seqDB search
MAKRVTGPEIEKLIQLLAKVPGLGPRSARRAALHLVKKKEQLLGPLAEAMGEAHRKVKIC
SCCGNVDTIDPCTVCTDERRDQAVIIVVEDVADLWALERAGAMNAAYHVLGGTLSPLDGI
GPEDLNIRGLIDRVAKGGVRELIIAVNATVEGQTTAHYITDQLEGMEVRITRLAHGVPVG
GELDYLDEGTLAAALRARTVI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcgagtcaccggtccggaaatcgagaaactcatccagcttctggcgaaagtc
ccgggcctcgggccccgttccgcccgccgcgcggcgctgcatctcgtcaagaagaaggag
cagttgctcggcccccttgccgaggctatgggcgaagcccatcgtaaggtcaagatctgc
tcctgctgcggcaatgtcgacaccatcgacccctgcacggtctgcaccgacgaacggcgc
gaccaggcggtgatcatcgtggtcgaggacgtcgccgatctttgggcgctggagcgcgcc
ggcgccatgaatgccgcctatcacgtgctcggcggcacgctgtcgccgctcgacggcatc
gggcctgaggatctgaacataaggggcctcatcgaccgcgtcgccaagggtggcgtgcgc
gagctgatcatcgccgtcaacgcgaccgtcgagggccagacgacggcgcactacatcacc
gatcaactcgaaggcatggaggtgagaatcacgcgcctcgcccatggcgtgcccgtcggc
ggcgagctcgactatctcgacgagggaacgctggccgccgcgcttagggcgagaacggtg
atttga

DBGET integrated database retrieval system