KEGG   Sinorhizobium meliloti AK83: Sinme_3696Help
Entry
Sinme_3696        CDS       T01521                                 

Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:smk03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3817454..3818359
Genome map
AA seq 301 aa AA seqDB search
MPELPEVETVKRGLAPTMEGALLVRAELRRPDLRFPFPENFANAVAGRRIIALSRRAKYL
MIELEGGDVIIAHLGMSGSFRIEKGPIEAGADPATPGAFHHPRGKDEKHDHVVFHLDGGS
GPARVIYNDPRRFGFMDLARRSALADHVFLRGLGEEPTGNALDAAYLATRFAGKIQPLKA
ALLDQRTIAGLGNIYVCEALWRSGLSPKRSAGTLVDKRGRPKQALIALTERIRAVIADAI
AAGGSSLKDHIQADGSLGYFQHSFSVYDREGEACRTPGCHGTVARIVQAGRSTFYCPHCQ
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgcccgaggtggaaacggtcaagcgcggactggcgccgacgatggagggt
gcgcttctggtgcgggcggagttgcgccggccggatctgcgctttccgttccccgagaat
ttcgcgaacgcggtcgcgggccgccggatcatcgccctctcgcggcgcgccaaatatctg
atgatcgagctcgagggcggcgacgtcatcatcgcccatctcggcatgtccggctcgttc
cggatcgagaagggcccgatagaggctggtgcggatccggccacgcccggcgctttccac
cacccgcgcggcaaggacgagaagcacgatcatgtcgtcttccatctcgatggcggctcc
gggccggcacgggtgatctataacgatccgcgtcgcttcggtttcatggatctggcacgg
cgctctgcgctcgccgaccacgtcttcctccgcggcctcggcgaggagccgaccggcaat
gccctcgatgccgcctatctcgccacccgtttcgccggcaagatccagccgctgaaagcc
gctcttctcgaccagaggacgatcgcggggctcggaaatatctatgtttgcgaggcgctg
tggcgctcgggcctctcgccgaaaaggtcggcaggcacgctcgtcgacaagcggggccgc
ccgaaacaggcgctgatcgcgctgacggaaaggatccgcgccgtgattgccgatgcgatc
gccgccggcggctcctcgctcaaggatcacattcaggcggacggcagtctcggctatttc
cagcacagcttctccgtctatgacagggaaggcgaggcttgccgcacgcccggctgccac
ggtacggtcgcccgcatagtacaggcgggacgttcgactttttactgtccgcactgccag
aaatag

DBGET integrated database retrieval system