KEGG   Sinorhizobium meliloti AK83: Sinme_3697Help
Entry
Sinme_3697        CDS       T01521                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00071  Fatty acid degradation
smk00280  Valine, leucine and isoleucine degradation
smk00281  Geraniol degradation
smk00310  Lysine degradation
smk00360  Phenylalanine metabolism
smk00362  Benzoate degradation
smk00380  Tryptophan metabolism
smk00410  beta-Alanine metabolism
smk00627  Aminobenzoate degradation
smk00640  Propanoate metabolism
smk00650  Butanoate metabolism
smk00903  Limonene and pinene degradation
smk00930  Caprolactam degradation
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01120  Microbial metabolism in diverse environments
smk01130  Biosynthesis of antibiotics
smk01212  Fatty acid metabolism
Module
smk_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sinme_3697
   00650 Butanoate metabolism
    Sinme_3697
  Lipid metabolism
   00071 Fatty acid degradation
    Sinme_3697
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sinme_3697
   00310 Lysine degradation
    Sinme_3697
   00360 Phenylalanine metabolism
    Sinme_3697
   00380 Tryptophan metabolism
    Sinme_3697
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sinme_3697
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sinme_3697
   00281 Geraniol degradation
    Sinme_3697
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sinme_3697
   00627 Aminobenzoate degradation
    Sinme_3697
   00930 Caprolactam degradation
    Sinme_3697
Enzymes [BR:smk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sinme_3697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEG55400
JGI: Sinme_3697
Position
1:3818417..3819190
Genome map
AA seq 257 aa AA seqDB search
MSYETLLVETQGRVGLITLNRPQALNALNAVLMRELDAALKAFDADRAVGAIVLAGSEKA
FAAGADIKEMQGLDFVDGYLADFLGGWEHVANARKPMIAAVSGFALGGGCELAMMCDFII
ASETAKFGQPEITLGVIPGMGGSQRLTRAVGKAKAMDLILTGRMMDAAEAERSGLVSRVV
APDRLLEEALGAAEKIASFSLPAAMMAKEAVNRSLELTLAEGLRFERRLFQSLFATEDQK
EGMAAFVAKRKAEFKHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagttacgagacgttgctggtcgaaacgcagggccgcgtgggcctgatcacgctcaac
cgtccgcaggcgctcaatgcgctgaatgcggtgctgatgcgcgagctcgatgccgcgctg
aaggccttcgacgccgacagggccgtcggcgccatcgtccttgccggctccgagaaggcc
tttgccgccggcgccgacatcaaggagatgcaggggctcgatttcgtcgacggttacctc
gccgatttccttggcggctgggagcatgtcgcgaacgcccgcaaaccgatgatcgccgcc
gtatccggtttcgcgctcggcggtggctgcgagctcgccatgatgtgcgacttcatcatc
gcctccgaaacggcgaagttcggccagccggagattacgcttggcgtcattcccggcatg
ggtggatcgcagcgcctgacccgcgcagtcggcaaggcgaaggccatggacctcattctc
accggccgcatgatggacgcggcggaggcggagcgctccgggctggtttcgcgcgtggtg
gctccggacaggctcctggaggaggcgctcggcgccgcggagaagatcgcgtcattctcg
ctgccggcggcgatgatggccaaggaggccgtcaaccgctctctggaactgacgctcgcc
gagggcctgcgcttcgagcggcggctcttccagtcgcttttcgcaacggaggaccagaaa
gagggcatggccgccttcgtcgccaagcgcaaagccgaattcaaacacagatga

DBGET integrated database retrieval system