KEGG   Sinorhizobium meliloti AK83: Sinme_4151Help
Entry
Sinme_4151        CDS       T01521                                 

Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk00020  Citrate cycle (TCA cycle)
smk00310  Lysine degradation
smk01100  Metabolic pathways
smk01110  Biosynthesis of secondary metabolites
smk01120  Microbial metabolism in diverse environments
smk01130  Biosynthesis of antibiotics
smk01200  Carbon metabolism
Module
smk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
smk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sinme_4151
  Amino acid metabolism
   00310 Lysine degradation
    Sinme_4151
Enzymes [BR:smk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sinme_4151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 BDV_G
Motif
Other DBs
NCBI-ProteinID: AEG55844
JGI: Sinme_4151
Position
2:471939..473075
Genome map
AA seq 378 aa AA seqDB search
MGGLIDIQAPLEQEGTKAVVRNWVRKIGDPVKSGDPLVELETDKVTQEVSAPADGVLAEI
LMRNGDDATPGAVLGRIGSEAAGAGHAPHYSPAVRHAAEEYGLDPATVTGTGRGGRVTRA
DMDRAFTARQEGPASVAAEAGDRGAAPKSRRIPHSGMRAAIAEHMLNSVTTAPHVTAVFE
ADFSAVMRHRDEHGKRLAADGTKLSYTAYVVSACVAAMRAVPEVNSRWHEDALETFDDIN
IGVGISLGDKGLVVPVIHRAQDLSLAEIAARLQDLTTRARSSALSRADVTGGTFTISNHG
ASGSLLAAPIIINQPQSAILGVGKLDKRVIVREVDGADTIQIRPMAYVSLTIDHRALDGH
QTNAWLTHFVRVIETWPK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcctcatcgacatccaggctccgctggagcaggaggggaccaaagcggtcgtc
cgcaattgggtcaggaagatcggcgatccggtcaaatcgggcgatcccctggtcgagctc
gagaccgacaaggtgacccaggaggtgtcggcgcccgccgacggggtgctcgcggaaatc
ctgatgcggaatggcgacgatgccacgcccggcgccgttctcggccggatcggcagcgag
gctgccggggcgggacacgcgccgcactactcgccggccgtacggcatgccgcggaagaa
tatggcctcgatccggccaccgtcaccggcaccggccgcggtggccgcgtcacgcgcgcc
gacatggacagggcgtttaccgcccggcaggaaggccctgcttcggtcgcggccgaggct
ggcgacagaggagccgcacccaagtcgcgcaggataccgcatagcggcatgcgcgccgcg
atcgccgaacatatgctcaactccgtcacgacggcgccgcatgtgacggccgtgttcgag
gccgatttctcggcggtgatgcgccatcgggacgagcatgggaagaggcttgccgcggac
ggcaccaagctctcctatacggcctatgtggtttcagcctgcgtggcggcgatgcgcgcg
gtccccgaggtcaacagccgctggcacgaggatgcgctcgaaacattcgacgacatcaat
atcggcgtaggtatttccctcggggacaagggcctggtcgtgccggtgatccatcgggcg
caggatttgtcgcttgccgagattgcggcccggctgcaggacctgacgacgcgtgcgcgc
tcgagcgcgctctcccgcgcggacgtgacgggcggcaccttcaccatttccaatcatgga
gcctccggatcgctactcgcggcgccgatcatcatcaaccagccgcaatcggcgatcctc
ggcgtgggcaagctcgacaagcgggtgatcgtccgcgaggtggacggcgccgacacgatc
cagatccgtccgatggcctatgtgtcgctgacgatcgaccatcgtgcgctggacggccac
cagacgaatgcgtggctgacgcatttcgtccgcgtgatcgagacctggccgaagtaa

DBGET integrated database retrieval system