KEGG   Sinorhizobium meliloti AK83: Sinme_4169Help
Entry
Sinme_4169        CDS       T01521                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sinme_4169
  Lipid metabolism
   00600 Sphingolipid metabolism
    Sinme_4169
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sinme_4169
Enzymes [BR:smk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Sinme_4169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(494015..496279)
Genome map
AA seq 754 aa AA seqDB search
MRSVTSFNDSWVFSEGFDAADAGTLRAGQPISLPHNAVELPFNYFDERCYQRAFTYQRVL
AWRPDFSGREVSLVFDAAMADAVVYLNGEEIVAHRDGYTPFEARLTDRLLEGDNLITVKI
DGSENPEIPPFGGRIDYLTYAGIYRDVWLKVTDPVSIANIKIETRDVLSDTKAVSLRCDL
SNPQGLSFSGTISALLKNAAGEVLAEVAGETTGQSLAFEMDGLKGLSLWDIDDPVLYVIE
VELRTGQGSDCFAAHFGFRTAEFTTEGFRLNGRPLKIRGLNRHQSFPYVGYAMGRTAQER
DADIMKHRLHCNLVRTSHYPQSKWFLDHCDRIGLLVFEEIPGWQHIGGEEWKQEAIRNVR
RMIERDWNHPSIVIWGVRINESQDSHDFYAETNRLARELDPTRQTGGVRYITDSEFLEDV
YTMNDFILGNEELPGSNRPRTALRPQQECTGLPRKVPYLITEFGGHMYPTKIYDQEQRQA
EHVRRHLEVLNAAYGDPGISGAIGWCMFDYNTHKDFGSGDRICYHGVMDMFREPKFAAYV
YASQCDPSEEIVMKPVTFWARGERNIGGVLPLIVLTNCDEIELKYGSLTKRVGPDRENFP
HLPHPPVVIDHRHFTKDELGVWGMKWESAEFTGFIAGKPVADLRMAADPVPTTLQVEADS
KTLRAEGRDSVRVILRALDQAGNVLPFLNDAVDIEIHGPARLVGPARIVLQGGSAGFWLE
STGAAGAIVVSVASSRLGAAKLDLVALADGAASA
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgcgctctgttacttccttcaatgattcatgggtcttctccgaaggcttcgacgccgcc
gacgccggaacgctccgggcgggtcagccgatcagcctgccgcacaatgccgtcgaactg
ccgttcaactatttcgacgagagatgctaccagcgcgccttcacctaccagagggttctt
gcctggcgcccggacttctccgggcgcgaggtctcgctcgtcttcgacgcggcaatggcc
gatgcggtcgtgtatctcaacggcgaagagatcgtcgcgcatagggacggctacacgcct
ttcgaggcgcgcctgacggacaggctcctggaaggcgacaatctcatcacggtgaagatc
gacggcagcgaaaatccggagatcccgcctttcggcggccggatcgactatctgacctat
gccggtatctatcgcgacgtctggctgaaggtcaccgatccggtttcgatcgccaatatc
aagatcgaaacccgcgacgtgctctccgacaccaaggccgtctccctccggtgtgacctt
tccaatccgcaagggctatccttctccggcacgatctcggcgctcctcaagaatgcggcc
ggcgaagtgctggccgaggtcgccggcgagacgaccggccagagcctcgcctttgaaatg
gacggcctcaagggcctttccctttgggatatcgatgatccggtgctctacgtgatcgaa
gtcgagctcaggaccggtcagggctccgactgcttcgccgcgcatttcggcttccgcacg
gcggagttcacgaccgagggcttccggctcaatggccgcccgctgaagatccgcgggctg
aaccgtcaccagtcttttccctatgtcggctacgctatggggcgcaccgcccaggagcgc
gacgctgacatcatgaagcacaggcttcactgcaatctcgtgcgcacctcgcattacccg
cagtcgaaatggttcctcgaccattgcgaccgcatcgggctcctcgtcttcgaagaaatc
cccggctggcagcatatcggtggggaggaatggaaacaggaggcaatccggaacgtccgc
cgcatgatcgagcgcgactggaaccacccgtcgatcgtcatctggggtgtgcgcatcaac
gagtcgcaggattcgcacgacttctatgccgagaccaatcgcctcgcccgcgagctcgac
ccgacacggcagacgggcggcgtgcgctacatcaccgacagcgaatttttggaagacgtc
tacacgatgaacgacttcatcctcggcaacgaggaactgccaggctcgaaccggccgcgc
acggctcttcgcccgcagcaggaatgtaccgggcttccccgcaaggtgccctatctcatc
accgaattcggcggccacatgtatccgacgaagatctatgatcaggagcagcgccaggcc
gagcatgttcgccggcacctggaggtgctgaatgcggcctatggcgatcccggcatctcc
ggtgcgatcggctggtgcatgttcgactacaacacccacaaggatttcggctccggcgac
cggatctgctatcacggcgtcatggacatgttccgcgagccgaaattcgcggcctatgtc
tatgccagccagtgcgatccctccgaggaaatcgtgatgaagccggtgaccttctgggcg
cgcggtgagcgcaacatcggcggcgtgctgcccttgatcgtgctgacgaattgcgacgag
atcgaattgaaatacggctcgcttaccaagcgcgtcggcccggatcgcgagaatttcccg
cacctgccgcatccaccggtcgtcatcgaccaccgccacttcaccaaggacgagctcgga
gtctggggcatgaagtgggagagcgcggaatttaccggcttcatcgccggcaagccggtc
gccgatctccgcatggccgccgaccccgtgcctacgacgcttcaggtcgaggcggacagc
aagacgctccgtgccgaaggccgcgacagcgttcgcgtcatcctgcgcgcgctcgaccag
gccggcaacgtcctgcctttcctgaacgatgcggtcgacatcgagattcatggtccggcg
cgcctcgtcggaccggcccgcatcgtcctccagggcggttccgccggtttctggctggag
tccacgggcgccgccggcgccatcgtcgtctcggtcgcgtcgtcgcggctcggcgcggcg
aagctcgacctcgtcgccctggcggacggagcggcgagcgcatga

DBGET integrated database retrieval system