KEGG   Sinorhizobium meliloti AK83: Sinme_4177Help
Entry
Sinme_4177        CDS       T01521                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sinme_4177
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sinme_4177
   00600 Sphingolipid metabolism
    Sinme_4177
Enzymes [BR:smk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Sinme_4177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:502504..503976
Genome map
AA seq 490 aa AA seqDB search
MASFKIAIIGAGSIGFTKKLFTDILSVPELRDVEFALTDLSEHNLAMIKSILDRIVEANE
LPTRVTATTDRRKALEGARYIISCVRVGGLEAYADDIRIPLKYGVDQCVGDTICAGGILY
GQRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQ
IAEILGARDGELDYICSGINHQTWFVDVRLNGRKVGKDELVAAFEAHPVFSKQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPDEISRWIDMSDWIHGETGGYLRYSTETRNWFETE
YPRFLEEAGRPLETIRRSNEHASRILEALETGRVYRGHFNVKNNGVITNLPADAIIESPG
FVDRFGINMVAGITLPEACAATCISSVNVQRMSVHAAITGDIDLLKLAVLHDPLVGAICT
PEEVWQMVDEMVVAQAKWLPQYAHAIDAAKERLARATVATREWKGAARREVRSIEEIRAE
KEAAKLRAAG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggccagcttcaagatcgccatcatcggcgccggcagcatcggcttcaccaagaagctc
ttcaccgacattctttccgtgccggagctccgggacgtcgagttcgcgttgacggatctg
agcgagcacaacctcgccatgatcaagtccatcctcgaccggatcgtcgaggcgaacgaa
ctgcccacgcgggtgacggcgacgaccgaccgccgcaaggcgctggaaggcgcacgctac
atcatcagctgtgtgcgcgtcggcggcctcgaggcctatgccgacgatattcgcattcca
ttgaagtacggcgtcgaccaatgcgtcggcgacacgatctgcgccggcggcatcctctac
ggccagcgaaacattccggtgatcctggatttttgcaaggacattcgcgaggtggcggag
cccggcgccaagttcctcaactatgccaacccgatggcgatgaacacctgggcggcgatc
gaatacggcaaggtcgacacggtcggtctctgccacggcgtccagcacggggccgagcag
atcgccgaaattctcggcgccagggacggggagctcgactacatctgctccggcatcaac
caccagacatggttcgtcgatgtccgtctcaacggccgcaaggtcggcaaggacgaactc
gtcgccgccttcgaggcgcatccggtcttttccaagcaggagaagctccggatcgacgta
ttgaagcgcttcggcgtctattcgaccgaaagcaacggacatctgtccgaatacctgccc
tggtaccgcaagcgtccggacgagatctccagatggatcgacatgtcggactggatccac
ggggagaccggcgggtatctccgctattcgaccgagacccgcaactggttcgagaccgaa
tatccgcgcttcctcgaagaggcgggccggccgctggaaacgatcaggcgctcgaacgaa
catgcgagccgcatcctcgaagcgctcgagacgggtcgggtctatcgcggccacttcaac
gtcaagaacaacggcgtgatcaccaacctgccggcagatgcgatcatcgaatcccccggc
ttcgtcgatcggttcggcatcaacatggtggcaggcatcacgttgccggaggcctgtgcg
gccacctgcatctcgtcggtcaacgtccagcgcatgtccgttcatgcggcgatcaccggc
gacatcgatctcctgaagctcgcggtgctgcacgacccgctggtcggcgccatctgcacg
ccggaggaagtctggcagatggtcgacgaaatggtggtcgcgcaggccaaatggctgccg
caatatgcccatgcgatcgacgcggccaaggaaaggctcgcccgcgccacggtcgccacc
cgggagtggaagggcgccgcgcgtcgcgaggtgcgctcgatcgaggagatccgagcggag
aaggaagcggcgaagctgcgcgctgcggggtag

DBGET integrated database retrieval system