KEGG   Sinorhizobium meliloti AK83: Sinme_4182Help
Entry
Sinme_4182        CDS       T01521                                 

Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sinme_4182
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sinme_4182
   00600 Sphingolipid metabolism
    Sinme_4182
Enzymes [BR:smk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Sinme_4182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:510254..511627
Genome map
AA seq 457 aa AA seqDB search
MTRQPRITFIGAGSTVFMKNIIGDILQRPALSAATIALMDVNPERLAESEIVAGKLARTL
GADARIETHSNQRKALEGADFVVVAFQIGGYEPCTVTDFEVPKKYGLRQTIADTLGVGGI
MRGLRTVPHLWKICEDMLEVCPEAILLQYVNPMAINTWAIAEKYPAIKQVGLCHSVQGTA
FELARDLDIPLDEIRYRAAGINHMAFYLKFEHRQKDGSYRDLYPDLIRGYREGRFPKPSH
WNPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKDGRPDLIEKFGIPLDEYPKRCVE
QIERWKGQAAAFKEAETIEVAESREYASSIMNSVWTGEPSVIYGNLRNNGCITSLPENCA
AEVPCLVDSSGILPTYIGALPPQLTALIRTNINVQELTVQALVTENREHLYHAAMMDPHT
AAELDLDQIWSLVDDLLAAHRDWIPEWARVTKKVAAA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacgagacaacccaggattactttcatcggtgccggttccaccgttttcatgaaaaac
atcatcggcgacatattgcagcgcccggcgctttcggccgcgaccatcgccctgatggac
gtcaaccccgagcggctcgccgaaagcgagatcgtcgccggcaaactggcgcgcacactt
ggcgccgatgccaggatcgaaacccattcgaaccagcgcaaggctctggaaggagcggac
ttcgtcgtcgtcgccttccagatcggcggttacgagccctgcacggtcaccgacttcgaa
gtgcctaagaaatacgggctgcgtcagacgatcgccgacacgctgggcgtcggcggcatc
atgcgcgggctccgcaccgtgccgcatctctggaaaatctgcgaggacatgctcgaggtc
tgccccgaggcgatccttctgcaatatgtgaatcccatggcgataaacacctgggcgatc
gccgagaaatatccggcgatcaagcaggtgggcctctgccattcggtgcagggcacggcc
ttcgagcttgcccgggacctcgacattccactcgacgaaatccgctaccgcgccgccggc
atcaaccacatggcgttttatctcaagttcgagcaccgccagaaggacggcagctatcgc
gatctctatccggacctgatccgcggctaccgcgagggccgcttccccaagcccagccac
tggaacccgcgctgccccaacaaggtgcgctacgagatgctgacgcggctcggttatttc
gtcaccgagagctcggagcatttcgccgagtacacgccctacttcatcaaggacgggcgc
cccgatctgatcgagaaattcggcattccgctcgatgaatatccgaagcgctgcgtcgag
cagatcgagcgctggaaggggcaggcggccgccttcaaggaggcggagacgatcgaagtc
gcggagagccgcgaatatgcctcctcgatcatgaattcggtctggaccggcgaaccttcg
gtcatctacggcaacctcaggaacaatggctgcatcacctcgctgccggaaaactgtgcg
gcggaagtgccctgcctcgtcgattcatccggcatcctaccgacctatatcggcgccctg
ccgccgcagctcacggccctgatccgcaccaacatcaacgtccaggaattgactgtccag
gcgctcgtcaccgagaaccgcgagcatctctatcacgcggcgatgatggatccgcatacc
gccgccgagctcgatctcgaccagatctggtcgctcgtggacgatctgctcgcggcgcac
cgcgactggatccccgaatgggcccgtgtgacgaagaaggtagcggccgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system