KEGG   Sinorhizobium meliloti AK83: Sinme_4583Help
Entry
Sinme_4583        CDS       T01521                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sinme_4583
Enzymes [BR:smk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Sinme_4583
Exosome [BR:smk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sinme_4583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:920043..921536
Genome map
AA seq 497 aa AA seqDB search
MGGYILAIDQGTTSTRAIVFDGNQKIAGVGQKEFKQHFPKSGWVEHDPEEIWQTVVSTVK
EAIEKSGITANDIAAIGITNQRETVVVWDRETGKPIHNAIVWQDRRTAAFCDKLKKKGLE
KTFVKKTGLLLDPYFSGTKLTWLLSNVKGAQARAAKGELCFGTIDTFLIWRLTGGKCFCT
DATNASRTLLYNIAENAWDDELTEILRVPKEMLPEVKDCAADFGVTDPSLFGAAIPILGV
AGDQQAATIGQACFKPGMLKSTYGTGCFALLNTGKDMVRSKNRLLTTIAYRLDGETTYAL
EGSIFVAGAAVQWLRDGLKVIKAAPDTGSLAESADPSQEVYLVPAFTGLGAPHWDPDARG
AIFGMTRNTGPAEFARAALEAVCYQTRDLLEAMHKDWRRNGNDTVLRVDGGMVASDWTMQ
RLSDLLDAPVDRPVILETTALGVAWLAGSRAGVWPNQEAFAKSWARDRRFEPHMDEATRK
VKLKGWRSAVKRTLIAA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgggcggatatattctcgcgatcgatcagggcacgacgtccacgcgcgcgatcgttttc
gacggcaaccagaaaatcgcgggcgtcgggcagaaagagttcaagcagcactttccgaag
tcaggctgggtggagcacgatccggaggagatctggcagacggtcgtcagcacggtcaag
gaagcgatcgagaagtccggcatcaccgcgaacgatattgccgcgatcggcatcaccaac
cagcgggagacggttgtcgtctgggatcgcgagaccggcaagccgatccacaatgccatc
gtctggcaggaccgccgcactgccgccttctgcgacaagctcaagaagaagggactggaa
aagaccttcgtgaagaagaccggtctgctgctcgatccctatttttcgggaacgaagctc
acatggctgctttccaatgtgaagggcgcgcaggcgcgcgcagccaaaggggaactctgc
ttcggcaccatcgacaccttcctgatctggcggctgacgggcggcaagtgcttctgcacc
gacgcgacgaatgcctcgcgtaccctcctatacaatatcgccgagaatgcctgggacgac
gagctcaccgagatcctgcgcgtgccgaaggagatgctgccggaagtgaaggactgcgcg
gccgacttcggcgtcacggatccgtctctcttcggcgcggcgatcccgatcctcggcgtt
gccggcgaccagcaggcggcaacgatcggtcaggcctgtttcaagccgggcatgctgaaa
tcgacctacggtacgggctgcttcgctttgctcaacaccggcaaggacatggtccgctcg
aagaaccgccttctgaccaccatcgcctaccgcctcgacggtgaaacgacctatgcgctc
gaaggctcgatcttcgtagccggtgctgccgtgcaatggctgcgcgacgggctcaaggtg
atcaaggcggcgcccgatacgggctcgcttgccgagagcgccgatccctcgcaggaggtc
tatctggtgccggccttcaccggcctcggagcgccccattgggatccggatgcgcggggc
gcgatcttcggcatgacgcgcaataccggcccggcagagttcgcacgggcggcactcgag
gccgtctgctaccagacccgcgacctgctggaggccatgcacaaggattggcgccgtaac
ggcaatgatacggtcctgcgcgtcgatggcggcatggtcgcctccgactggacgatgcag
cgcctgtcggacctgctcgacgctccggtcgaccgcccggtcattctcgaaaccaccgcg
ctcggcgtcgcgtggcttgcaggcagccgcgccggcgtctggccaaaccaggaggcgttc
gccaagtcctgggcccgcgaccgccgcttcgagccgcacatggacgaggccacgcgcaag
gtgaagctcaagggctggcgcagcgcagtcaagcggacgttgattgctgcctga

DBGET integrated database retrieval system