KEGG   Sinorhizobium meliloti AK83: Sinme_4878Help
Entry
Sinme_4878        CDS       T01521                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sinme_4878
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sinme_4878
Enzymes [BR:smk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sinme_4878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1262182..1264101)
Genome map
AA seq 639 aa AA seqDB search
MLPVLYRLESAWQPDGGPFGRFTFSLFNLSGGPLSAFRLVYTSLTRVIDRAACENAVFLR
RNANFHEFAPPEGLTLAHGDHWTFTVSGLHREAKHCTDGAKSAYLTLADGSHVPVAVSDL
RLEGAASELPPVRLPKGRLELPFALQPWPAEIDAAPGAAVPDVLYPAAGSNADEVDAVSN
VLALFHRLFSAGHAPFSLAPSPQGLPIVFKKKAELEGEAYGLAFSDREIRLDYGAAAGRQ
YALTTLAQLIDGARNHGGDFRFPASGEIADRPRYGWRGCHLDVSRQFYPTADIVRLIDIL
AWFKLNIFHWHLTDDEAWRLEIKAYPTLTTLGVVRGPDEPMLPQLGNGAEPVGGFYSHAD
VKAIVAHAAALSIEVVPEIDIPGHSTAALVALPELSDGQEAPESYHSVQGYPNNALNPAI
PLTYEFLEKVFDEMVELFPSRYIHVGGDEVADGSWLASPLARKLMEQEGISGTFALQSYF
LKKVKQMLTARGRKLVGWNEVAHGGGVGTEGTLLMAWENPKVGIELAREGYDVVMTPGQA
YYLDMAQADAWQEPGASWAGTATPAHTYAYETEGEFPEELKSRMKGVQACIWSEHFLSRG
YFNRLVFPRLPAIAEAAWTPKDKKDWLRFAAIAPLSPIL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgctgccggttctctatcgcctcgaatctgcctggcaaccggatggcggcccgttcggg
cgcttcaccttcagcctcttcaatctatcgggcgggccgctcagcgccttccggctggtc
tacacctcgctcacccgcgtcattgaccgagccgcttgcgaaaacgccgttttcctgcgc
cgcaacgccaattttcatgaattcgcgccgcccgaaggactgacgctcgcccatggcgac
cactggacgttcaccgtcagtggtctgcaccgcgaggcgaagcattgcaccgacggggca
aaatcggcctatctgaccctcgccgatggcagccatgttcccgtggcggtctccgatctg
cgtctcgaaggcgctgcgagcgagctgccgccggtgcgtcttcccaaaggccggctcgag
cttcctttcgcgctgcagccctggcctgccgagatcgacgcggcgcctggagcagcggta
ccggacgtcctctatcccgcagcaggaagcaatgcggacgaggtcgatgccgtctccaac
gtcctcgcgctcttccatcggctgttttcggccggacacgctcccttcagtcttgcgccg
tccccgcaagggctgccgatcgtcttcaagaaaaaagcggagctcgaaggcgaagcctac
gggcttgccttttccgatcgggagatccggcttgactatggagcggcggccggcaggcaa
tatgccctgacgacgctcgcgcagttgatcgacggcgcgcgaaaccacggaggcgatttc
aggtttcccgcctccggcgaaatcgcggaccggccacgctatggctggcgcggctgtcac
ctcgatgtctcgcggcaattctacccgacggccgacatcgtgcggctcatcgatattctc
gcctggttcaagctcaacatcttccactggcacctgaccgacgatgaagcctggcggctg
gagatcaaggcctatccgacgctgacgacgctcggcgtcgtgcgcggcccggacgagcct
atgctgcctcaactcggcaacggcgccgaaccggtcggcggcttctacagccacgcggac
gtgaaggcgatcgtcgcgcatgctgcggcgctcagcatagaagtcgtcccggagatcgac
atacccggccacagcactgccgcgctcgtggcgcttcccgaactctccgatggccaggag
gcgccggaaagctaccactcggtccagggctatccgaacaatgccctgaacccggccatc
ccgctcacctatgaattcctagagaaggtgttcgacgaaatggtcgagctctttcccagc
cggtatatccatgtcggcggggacgaggtggccgacggctcatggctcgcgtcaccgctg
gcgcgaaagctcatggagcaggaagggatttccggcaccttcgcgctgcagtcctatttc
ctcaagaaggtgaaacagatgctgacggcgcgcgggcgcaaactcgttggctggaacgag
gtcgcgcatggcggcggcgttggaaccgagggcacgctgctgatggcctgggagaacccg
aaagtcggcatcgagcttgcgcgcgaaggctacgacgtcgtgatgaccccgggtcaggcc
tattatctcgacatggcccaggcggatgcgtggcaggagcccggcgcgagctgggccggc
acggcgacgccggcgcacacctatgcctatgagacggaaggagagttcccggaagagctg
aagagccggatgaagggagtccaggcctgcatctggtccgagcatttcctgtcgcgcggt
tatttcaaccgcctcgtctttccccggctgccggcaatcgccgaggcggcctggaccccg
aaggacaagaaggattggctgcgctttgccgcgatcgcgcccttgagtcccattctgtga

DBGET integrated database retrieval system