KEGG   Sinorhizobium meliloti AK83: Sinme_5253Help
Entry
Sinme_5253        CDS       T01521                                 

Definition
MCP methyltransferase/methylesterase CheR/CheB with PAS/PAC sensor
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:smk02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:smk02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1649533..1653018)
Genome map
AA seq 1161 aa AA seqDB search
MGRELDPPIVAIGASAGGIQALQTFFDLIPNDTGATFVVIVHLDPHARSELANILAARTR
MSVTQVEDQARLEGNHVYVIAPNRQLKIADGTITALPFEEPHALRAPIDLFFRSLAEEHG
SELAVILTGAGADGAIGVKAVKEAGGIVLVQDPEEAEYASMPRNAIDTEVADFVLPIREL
PHRVAELLADRDQLPSEPFHADDDDMIGRILAHVRGRTGHDFSQYKRATILRRIGRRAQI
AGRETFADYYNYLRENPEEAQALFSDFLISVTTFFRDPSAFEALAERVIPQLFDGKEVAD
AIRVWVPGCATGEETYTMGMLLLEEAARRDLSPEIQVFGSDLDAQALRIAREGRYPSTIE
SDLSEERLRRFFQREGDHYRVRRELRDVVLFASHSLLRDPPFSHLDMISCRNLLIYLDRQ
LQQQVCNTFHYALNAGGFLFLGSSESADHPGLFLTVDREARIYRAVAGGGARRPMVLPAL
LGPHKPEIKSTIIRMPAAGHVSDAAVHRQMLEKIAPPSMLVDESHHAIHLSENAGRFLQP
SGGPVSTDATDLVREEFRFDLRAALHRAFERNEPTLSMPILADLDGQPHRVYLQVKPVVQ
GTERTRHALVLFIEGEAIDKTQEVVLDTLDGRPTIDEAIRRLQEELQLAQNRLRLTSEES
ATANEELRAANEELQSMNEEYRSTAEELETSKEELQSINEELQTVNSELKLKLESISRAH
SDLQNLMAATDIATLFLDPSLRIKRFTPRLTEIFNVTPSDEGRPITDFTHHLKYKRLSDD
ARAVLETLTPVEHEVKSRDDGWYLVRMRPYRTMEDKIDGVVVTFVDISERRHAEEAAKES
GQRLEQEMRLVELSRSPIFVWDFDDGIMQWNRGSEELYGYLREEALGRRKEELLKTAVPG
SSFDKLRRTLSQKRRWSGELNHTTKDGRVLTVESQIELVPFGERRLVLESTRDISDRKRW
ERRGQLLLNELSHRVKNTLAVVQSLARQTLRTTRSSEDFVERFEGRLAALASAHKLLVDS
EWRGAELDALARGQLDAYAGSDRRRLQIEGEPVTLPPDLATPFGLVLHELATNAAKYGAF
STGIGQVRLSWKLGNNGRNLGVIWQERGGPPVEPPSEQGFGGVLIEKSLPGSTVHRDFQP
DGVVCTIDIELPEIPPDGAEK
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgagaattggatcctccgattgtcgcaatcggagcctctgcgggtggcattcag
gctcttcagaccttctttgatcttataccgaatgacacgggcgccaccttcgtcgtcatt
gtccatctcgatccgcacgccagaagcgagcttgcgaacattttggcggcacggacgcgc
atgtcggttacacaggtcgaggaccaagcgcgccttgaaggcaaccacgtatacgtcatt
gcgccgaaccgtcagcttaagattgccgacggtacgataaccgcgctccccttcgaagag
ccgcatgccctccgggcgcctattgatcttttctttcggtcgctcgccgaggagcatggg
agcgaacttgcggtcattctcactggtgccggggcggacggtgcgattggggtgaaggct
gtcaaggaggcgggcggaatcgtgctcgtccaggatcctgaagaggcagaatatgcctcc
atgccgcgcaatgccatcgacactgaggttgcagacttcgtgctgcctatccgggagctt
cctcatcgggtggctgagttgctcgccgatcgtgatcaacttccgtccgagccgttccac
gcagacgatgacgatatgatcgggcgaattctcgcccatgtgcgcggccgaaccggacac
gatttctcccaatacaagcgggctacgattttgcggcgtatcggacggcgagcgcaaatt
gccgggcgggagacctttgcggactactacaactacctgcgtgagaatcccgaagaagcc
caggcgctgttcagcgactttttgatttcggttacgacgttctttcgcgatccctcggct
ttcgaggctcttgccgaacgagtcatcccgcaattgtttgacggaaaagaagtcgccgac
gcgatcagggtctgggttccgggctgcgccaccggtgaggaaacctatacgatgggcatg
cttctgcttgaggaggcggcacgccgcgacctttcgccggaaatccaggtcttcggctca
gacctcgacgcacaggcactgcgcatcgcgcgcgaaggacgatacccatcgactatcgaa
agcgatctctcggaggaacgactgcgccggttctttcagcgtgagggagatcactatcga
gtgcgccgcgagttgcgcgatgtggttctctttgccagccacagcttgctcagagacccg
ccgttctcccatctcgatatgatttcctgccgaaacctgctgatctatctcgatcggcag
ctgcagcagcaggtgtgcaatacgtttcattacgcgctcaacgcaggtggctttctcttt
ctcggatcgtcggaaagtgccgaccaccccgggctcttcctcactgtggatcgcgaggca
cgtatctacagggctgtcgcaggcggcggtgctcgacgacccatggtgctgccggcgctg
cttggtccacataagccggaaattaaatcgaccatcattcggatgccggcggcagggcac
gtcagcgacgcagcggtacaccgccagatgctcgagaaaatcgctcctccaagcatgctg
gtcgatgaaagtcaccacgcgattcatctttcggaaaacgccggacgctttctccaaccc
tcaggtggccccgtcagtaccgacgcgacggatctcgtgcgcgaggaatttcgcttcgat
ctaagagcggcgctgcaccgggccttcgagcggaatgagcccacgttgagcatgcccatc
cttgctgacctggacgggcaaccgcaccgcgtctacctgcaagtgaagccggtggtccaa
gggacggaacgcacccggcatgcccttgtgctttttatcgaaggcgaggcaatcgacaaa
acccaggaggtcgtgctcgatacgcttgatgggcgcccgacgatcgacgaggcgatccgc
cgcttgcaggaggagctgcagctcgcgcaaaaccggcttcgcctgaccagcgaggagtcg
gccaccgccaacgaagaactgcgggctgccaacgaagaactgcagtcaatgaacgaggaa
taccgttcgacggccgaggaactggaaacgagcaaggaagagctccaatcgatcaatgag
gagctgcaaaccgtcaacagtgagctcaaactgaagctggaaagcatatcgcgggctcac
agcgacttgcagaacttgatggccgcgaccgacatcgcgacgcttttcctcgacccgtcc
cttcgtatcaagcgttttaccccgcggctgacggagatattcaacgtcacgccgagcgac
gaaggccggccgatcactgatttcacgcatcatcttaaatataagagactttctgatgac
gcacgcgcggtgctcgagacgctcacgccagtcgagcacgaggtgaagagccgcgatgac
ggctggtatttggtgcggatgcgcccctaccgcacgatggaagacaagatagacggcgtt
gtggtgaccttcgtcgacatcagcgagcggcgccatgccgaagaggcggcgaaggagagc
gggcaacgccttgagcaggaaatgcggctcgtcgagctttcccgctcaccgatattcgtg
tgggactttgacgatggcataatgcagtggaaccgcggcagcgaggaactctatggctat
ttgcgtgaggaggcgcttggaaggcgcaaggaagaactgctaaagacggccgttcccggc
tcgtcctttgacaagctcaggcgaacactcagccaaaagcgccgttggagcggcgaactg
aaccataccacgaaggacggtcgagtgctgacggtagagagccagatcgagctcgtgccg
tttggcgagcgccggcttgtgctggaaagcacccgcgacatttccgaccgcaaacgctgg
gagcggcgcgggcagctcttgctgaacgagctaagccatcgggtgaagaacacgctcgct
gtcgtccagtcgctggcgcgccagacgctccgcacaacccgatcgagcgaggacttcgtc
gagcgctttgaagggcgcctcgcagcacttgcgagtgcccataagctgcttgtcgattct
gaatggcgcggcgccgagcttgacgcactggcgcgagggcaactcgatgcctacgccggc
agcgatcggcgccgactgcagatcgagggcgagccagtgacgctgccgccggacctcgct
acaccgttcggtctcgtgctccacgagctcgcgaccaatgccgcgaaatacggcgcgttt
tctactggaatcggacaggtcaggctcagttggaaactcgggaacaacggccggaacctt
ggggttatctggcaagaacgcggtggcccgccggtcgagccgccgagcgagcagggtttc
ggcggcgttctgatcgagaagagcttgccaggatctacggttcatcgcgatttccaaccg
gatggcgtcgtctgcacgatcgacatcgagcttccggagatcccgccagatggcgcggaa
aagtga

DBGET integrated database retrieval system