KEGG   Sinorhizobium meliloti AK83: Sinme_5760Help
Entry
Sinme_5760        CDS       T01521                                 

Definition
phosphoenolpyruvate mutase (EC:5.4.2.9)
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Metabolism of other amino acids; Phosphonate and phosphinate metabolism [PATH:smk00440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:467781..468653
Genome map
AA seq 290 aa AA seqDB search
MSKSKRLRERMAKRGLVHIMATHSPLSAVLAEEAGFDGLWASGFELSALYGVPDMSLISM
TQHLDMLRAIAGRSSLPIVADIDTGYGNAINVIHAISEYERAGASAVVIEDKTFPKVTSL
VDGGRQELLRIEEFQGKIEACINTRRDPDFLVIARTEALIAGLGEEEALKRARAYEAAGA
DMILIHSKKKEPSEIESFARAWDGNVPLTVVPNAYPELDASRIEALGNIRMVIYGNYGVR
AATAAMQTAFRRIIADGGVQNVHKDIAPVEEIFRLQRTDETKVNERAFLR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtcaaagcgattgcgtgaacgcatggccaagcgtggcctcgttcacatcatg
gcaacgcacagtccgctttcggcggtcctcgccgaggaagccggtttcgacggcttgtgg
gcctccggattcgaactctcggccctctatggcgtgcccgacatgagtttgatctcgatg
acgcaacacctcgacatgttgcgtgcgatcgccggtcggtcgtcgctgccgattgtcgct
gatatcgacaccggctacggcaatgccatcaacgtcatccacgcaatcagcgaatatgaa
cgcgccggcgcatcggctgtcgtcatcgaggacaagacctttcccaaggtgaccagtctc
gttgatggcgggcgccaggagttgctccggatcgaggagttccagggcaagatcgaggcc
tgcatcaatacccgtagggatccggattttttggtgatcgctcgcaccgaggcgttgatc
gccggccttggagaggaggaggcgctaaagcgcgctcgcgcctatgaagccgccggcgcc
gatatgatcctcatccattccaaaaagaaggagccctccgagatcgagtccttcgcgcgg
gcctgggacggcaatgtgccgctgaccgtcgttccgaacgcctatccggagctcgacgct
tccaggatagaagcgctcggcaatattcgaatggtgatctacggaaattacggcgtgcgc
gcagcaaccgcagcgatgcaaacggctttccggcgcatcattgccgatggcggcgtgcag
aacgttcataaggacatcgcgcctgtcgaggagatcttccggctacagcgcaccgacgaa
accaaggtgaacgagcgagcgttcctgcgctag

DBGET integrated database retrieval system