KEGG   Sinorhizobium meliloti AK83: Sinme_6004Help
Entry
Sinme_6004        CDS       T01521                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:smk00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Sinme_6004
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sinme_6004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(711293..711661)
Genome map
AA seq 122 aa AA seqDB search
MNKVVIAALVSLAVSGHATPALSQEAAPGQKLFQQRCGACHQLETPRNGVGPHLLGVVGR
TAARVDGFRYSAALKGSGIAWTAETRETFLSNPAAMVRGTRMAQRFNNADERRAIIAFLR
AQ
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaggtcgtcattgctgcgctcgtttctcttgctgtttcaggccacgccacgccg
gctctgtctcaggaggctgcaccaggtcagaagctgtttcagcaacgctgcggtgcgtgc
catcagctcgagacacctcgaaacggcgtcggaccgcatctgctgggtgtcgtcggccga
acggccgcccgcgttgacggcttcaggtattccgcggctcttaaaggttccggtatcgca
tggaccgccgaaacgcgggaaaccttcctgagcaatcccgccgcgatggttcgcggaacg
cgcatggcccagcgtttcaacaacgccgacgagcgtcgagcgatcatcgcgttccttagg
gcgcaatag

DBGET integrated database retrieval system