KEGG   Sinorhizobium meliloti AK83: Sinme_6004Help
Entry
Sinme_6004        CDS       T01521                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
smk  Sinorhizobium meliloti AK83
Pathway
smk01100  Metabolic pathways
smk01120  Microbial metabolism in diverse environments
smk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sinme_6004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: AEG57519
JGI: Sinme_6004
Position
3:complement(711293..711661)
Genome map
AA seq 122 aa AA seqDB search
MNKVVIAALVSLAVSGHATPALSQEAAPGQKLFQQRCGACHQLETPRNGVGPHLLGVVGR
TAARVDGFRYSAALKGSGIAWTAETRETFLSNPAAMVRGTRMAQRFNNADERRAIIAFLR
AQ
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaaggtcgtcattgctgcgctcgtttctcttgctgtttcaggccacgccacgccg
gctctgtctcaggaggctgcaccaggtcagaagctgtttcagcaacgctgcggtgcgtgc
catcagctcgagacacctcgaaacggcgtcggaccgcatctgctgggtgtcgtcggccga
acggccgcccgcgttgacggcttcaggtattccgcggctcttaaaggttccggtatcgca
tggaccgccgaaacgcgggaaaccttcctgagcaatcccgccgcgatggttcgcggaacg
cgcatggcccagcgtttcaacaacgccgacgagcgtcgagcgatcatcgcgttccttagg
gcgcaatag

DBGET integrated database retrieval system