KEGG   Sinorhizobium meliloti AK83: Sinme_6037Help
Entry
Sinme_6037        CDS       T01521                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
smk  Sinorhizobium meliloti AK83
Brite
Enzymes [BR:smk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Sinme_6037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:745217..745888
Genome map
AA seq 223 aa AA seqDB search
MKPMNEEHLAVLRRHMVEVVAIYADLASEELGKAALDERVMAAMLRVPRHLFVPAQAAPF
AYQDMPLPIGFDKTVSQPFMVALMTDLLAPKPHEAVLEIGTGLGYQTAILAQLAGKIWSV
EIIEEFASHAEALLHGLGMSNVGIRIGDGSRGWPEHAPFDKILVTAAAEEPPPALLEQLK
PMGRLVLPVGSEEQVLTVIDKDSEGQFLARQLIPVRFSKLEAV
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaatgaacgaagagcacctcgccgttctgcgcaggcacatggtcgaggtggtc
gcaatctatgccgaccttgcaagtgaagaactcggcaaggccgcactcgatgaacgggta
atggcagcgatgctgcgggtaccgcggcatctgttcgtgcccgcccaagctgcgcccttt
gcctaccaggacatgccgcttccgatcggcttcgataaaaccgtgtcgcagcccttcatg
gtcgcactcatgaccgatctccttgctcccaaaccgcatgaggccgtgcttgagatcggc
accggcctaggctatcaaaccgcaatcctcgctcaactcgccgggaagatttggagcgtc
gagatcattgaggaattcgcaagccatgccgaggctctcctgcacggcctcggcatgtct
aatgttggcattcgtatcggcgacggttcacgcggctggcctgagcacgctccattcgac
aagatcctggtcacagcggcggctgaggagccgcctccggctttgctcgagcagctcaag
ccaatgggccgccttgttcttcctgtgggttcggaagaacaggtgctgactgtcatcgac
aaggattcggaagggcaattcctggcgcggcaactcatcccggttcggttcagcaagctc
gaggcggtctaa

DBGET integrated database retrieval system